| Clone Name | bast44d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TSP3_HUMAN (P49746) Thrombospondin-3 precursor | 30 | 2.0 | 2 | SPT5H_CAEEL (Q21338) Transcription elongation factor SPT5 (DRB s... | 30 | 2.0 | 3 | TSP3_MOUSE (Q05895) Thrombospondin-3 precursor | 29 | 2.6 | 4 | NEBU_HUMAN (P20929) Nebulin | 28 | 4.5 | 5 | THAP8_HUMAN (Q8NA92) THAP domain-containing protein 8 | 28 | 5.9 | 6 | SPT_ARATH (Q9FUA4) Protein SPATULA | 28 | 7.7 | 7 | DTNB_MOUSE (O70585) Dystrobrevin beta (Beta-dystrobrevin) (DTN-B... | 28 | 7.7 |
|---|
>TSP3_HUMAN (P49746) Thrombospondin-3 precursor| Length = 956 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +2 Query: 38 SKHIFPRASCHLPAYLAPQFFSHQQTQNSGPASCRRHDGGEGGAGCC 178 S+ P +CH PA+ +H + +G SC+ + G G C Sbjct: 409 SQGCLPARTCHSPAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVC 455
>SPT5H_CAEEL (Q21338) Transcription elongation factor SPT5 (DRB| sensitivity-inducing factor large subunit) (DSIF large subunit) Length = 1208 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 155 PHHGAGS*LVHCFGFADGRRTAVQGRQVGGRMPA 54 P +G S +G ADG RT G GGR PA Sbjct: 868 PAYGNDSSRTPAYGSADGARTPAYGSTEGGRTPA 901
>TSP3_MOUSE (Q05895) Thrombospondin-3 precursor| Length = 956 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +2 Query: 38 SKHIFPRASCHLPAYLAPQFFSHQQTQNSGPASCRRHDGGEGGAGCC 178 S+ P +CH PA+ +H + +G SC+ + G G C Sbjct: 409 SQGCVPARTCHSPAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVC 455
>NEBU_HUMAN (P20929) Nebulin| Length = 6669 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 32 YHSKHIFPRASCHLPAYLAPQFFSHQ 109 Y +KH R CH+PA APQF H+ Sbjct: 773 YKAKHEGERFKCHIPAD-APQFIQHR 797
>THAP8_HUMAN (Q8NA92) THAP domain-containing protein 8| Length = 274 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 15 RLIAPATIPSTYSRGHPATYLPTLHRSSSPISKP 116 R + P +PS +SRG PA + P+S P Sbjct: 74 RYLRPDAVPSIFSRGPPAKSQRRTRSTQKPVSPP 107
>SPT_ARATH (Q9FUA4) Protein SPATULA| Length = 373 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 146 GAGS*LVHCFGFADG-RRTAVQGRQVGGRMPAGICAWNGSGGNQSTCES 3 G+GS CFGF+ G VQG G R+ + +G+ ++ CES Sbjct: 122 GSGS-AAACFGFSGGGNNNNVQGNSSGTRVSSSSVGASGNETDEYDCES 169
>DTNB_MOUSE (O70585) Dystrobrevin beta (Beta-dystrobrevin) (DTN-B) (MDTN-B)| Length = 700 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 241 AARPLAAAGETTRPPT 194 AARP A AG TRPPT Sbjct: 409 AARPAAEAGNMTRPPT 424 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,156,938 Number of Sequences: 219361 Number of extensions: 657312 Number of successful extensions: 2509 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2507 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)