| Clone Name | bast43h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHER1_VIBCH (Q9KQ06) Chemotaxis protein methyltransferase 1 (EC ... | 29 | 3.8 | 2 | CHER_VIBPA (Q9X9K2) Chemotaxis protein methyltransferase (EC 2.1... | 28 | 6.5 | 3 | MEGF9_MOUSE (Q8BH27) Multiple epidermal growth factor-like domai... | 28 | 6.5 |
|---|
>CHER1_VIBCH (Q9KQ06) Chemotaxis protein methyltransferase 1 (EC 2.1.1.80)| Length = 275 Score = 28.9 bits (63), Expect = 3.8 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 195 WCSFWSAGQAPYQIGWTVMSA--ARTGPMWYSSLTRSDDPSNFLDAPRAATASRGGHGR 25 W + S+GQ PY + T++ R G + S+T +D ++ LD RA GR Sbjct: 108 WSAASSSGQEPYSMAMTILEVQQKRPGLLPSVSITATDISASMLDMCRAGIYDNLALGR 166
>CHER_VIBPA (Q9X9K2) Chemotaxis protein methyltransferase (EC 2.1.1.80)| Length = 275 Score = 28.1 bits (61), Expect = 6.5 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 195 WCSFWSAGQAPYQIGWTVMSAARTGP--MWYSSLTRSDDPSNFLDAPRAATASRGGHGR 25 W + S+GQ PY I T++ + P + S+T +D ++ L+ RA GR Sbjct: 108 WSAASSSGQEPYSIAMTILETQQRKPGLLPSVSITATDISASMLEMCRAGVYDNLALGR 166
>MEGF9_MOUSE (Q8BH27) Multiple epidermal growth factor-like domains 9 precursor| (EGF-like domain-containing protein 5) (Multiple EGF-like domain protein 5) Length = 600 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 2 AAPLAMAWRPWPPRDAVAALGASKKFEGSSDLV 100 AAP A A R PPR V GA+ GS +++ Sbjct: 67 AAPTAQAPRTGPPRTTVRKTGATTPSAGSPEII 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.295 0.107 0.282 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,759,035 Number of Sequences: 219361 Number of extensions: 270414 Number of successful extensions: 504 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 17 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 44 (21.9 bits)