| Clone Name | bast43h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YDIU_ECOLI (P77649) UPF0061 protein ydiU | 28 | 4.8 |
|---|
>YDIU_ECOLI (P77649) UPF0061 protein ydiU| Length = 478 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -2 Query: 158 RYIVSHYSVDATCQYQYWQSSNSGRSTSLVQQWETV 51 R+ SH + D +Y+ W S R+ SL+ QW+TV Sbjct: 202 RHYWSHLADDED-KYRLWFSDVVARTASLIAQWQTV 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,383,859 Number of Sequences: 219361 Number of extensions: 479012 Number of successful extensions: 1208 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1208 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)