| Clone Name | bast43f07 |
|---|---|
| Clone Library Name | barley_pub |
>PGLR2_JUNAS (Q9FY19) Polygalacturonase precursor (PG) (EC 3.2.1.15) (Pectinase)| (Major pollen allergen Jun a 2) Length = 507 Score = 30.0 bits (66), Expect = 2.4 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +3 Query: 108 GPAEPHLSYKIHQHSSSYPQPRDFPSEQLYHAYFAIQRF 224 GP +PH S+K+ ++YP P + + +++ + + F Sbjct: 111 GPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDF 149
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 30.0 bits (66), Expect = 2.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 188 AALPCILRHPAIQEHHHLRPQKRNQHLDRPRH 283 AALP HP HHH P + + H P H Sbjct: 999 AALPPAHHHPPHHHHHHAPPPQPHHHHAHPPH 1030
>CHRA_PSEAE (P14285) Chromate transport protein| Length = 416 Score = 29.3 bits (64), Expect = 4.1 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = -1 Query: 388 EHRPKPSKMTDVTVRLLACPCGAPQLKPR*LVVAQMSWPVQVLVTFLGSEVMVFLNRWMA 209 E +PSK TD T + P PQL R L ++W V + +V RW++ Sbjct: 6 EESYRPSKATDATTEAVPPPMSYPQLFARFLKFGLLAWGGPVAQIDMLRRELVDEERWIS 65
>ZNF92_HUMAN (Q03936) Zinc finger protein 92 (Zinc finger protein HTF12)| Length = 586 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 252 NVTSTWTGHDICATT--SYLGFNCGAPHGQASNLTVTSVIFDG 374 N +S +T H I T SY CG Q+SNLT +I+ G Sbjct: 491 NQSSIFTKHKIIHTEGKSYKCEKCGNAFNQSSNLTARKIIYTG 533
>3MGH_STAAW (P65416) Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)| Length = 202 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 249 KNVTSTWTGHDICATTSYLGFNCGAPHGQASNLT--VTSV 362 ++ T T+TG+ I T +YLG N A HG +T VTS+ Sbjct: 23 QDTTQTYTGY-IVETEAYLGLNDRAAHGYGGKITPKVTSL 61
>3MGH_STAAS (Q6G6X6) Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)| Length = 202 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 249 KNVTSTWTGHDICATTSYLGFNCGAPHGQASNLT--VTSV 362 ++ T T+TG+ I T +YLG N A HG +T VTS+ Sbjct: 23 QDTTQTYTGY-IVETEAYLGLNDRAAHGYGGKITPKVTSL 61
>3MGH_STAAR (Q6GE90) Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)| Length = 202 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 249 KNVTSTWTGHDICATTSYLGFNCGAPHGQASNLT--VTSV 362 ++ T T+TG+ I T +YLG N A HG +T VTS+ Sbjct: 23 QDTTQTYTGY-IVETEAYLGLNDRAAHGYGGKITPKVTSL 61
>3MGH_STAAN (P65415) Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)| Length = 202 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 249 KNVTSTWTGHDICATTSYLGFNCGAPHGQASNLT--VTSV 362 ++ T T+TG+ I T +YLG N A HG +T VTS+ Sbjct: 23 QDTTQTYTGY-IVETEAYLGLNDRAAHGYGGKITPKVTSL 61
>3MGH_STAAM (P65414) Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)| Length = 202 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 249 KNVTSTWTGHDICATTSYLGFNCGAPHGQASNLT--VTSV 362 ++ T T+TG+ I T +YLG N A HG +T VTS+ Sbjct: 23 QDTTQTYTGY-IVETEAYLGLNDRAAHGYGGKITPKVTSL 61
>3MGH_STAAC (Q5HDL2) Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)| Length = 202 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 249 KNVTSTWTGHDICATTSYLGFNCGAPHGQASNLT--VTSV 362 ++ T T+TG+ I T +YLG N A HG +T VTS+ Sbjct: 23 QDTTQTYTGY-IVETEAYLGLNDRAAHGYGGKITPKVTSL 61
>YRPE_BACSU (O05410) Hypothetical protein yrpE| Length = 251 Score = 29.3 bits (64), Expect = 4.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +3 Query: 141 HQHSSSYPQPRDFPSEQLYHAYFAIQRFKNTITSD 245 H+HS + D +E++Y YF + K+ + SD Sbjct: 59 HEHSHDHSHAHDEETEKIYEGYFKNSQVKDRLLSD 93
>K502_ACTCH (P43394) Fruit protein PKIWI502| Length = 317 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 104 SRPR*ATPVL*DTPAFFLVPTAT*LPKRAALPCILRHPAIQEHHHLR 244 SRP + P L P+ L + + P LRHP ++ HHH R Sbjct: 6 SRPSLSRPSLSRHPSLTLHSSLSHAPPHHRPVAFLRHPTLRYHHHGR 52
>CTXA_CHIQU (P58762) Toxin A precursor (CqTX-A)| Length = 462 Score = 28.5 bits (62), Expect = 7.1 Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 5/63 (7%) Frame = +3 Query: 159 YPQPRDFPSEQLYHAYFAIQ-----RFKNTITSDPKNVTSTWTGHDICATTSYLGFNCGA 323 YP+ R+ S++++ + ++ R K +T + W + +C++ YL C Sbjct: 293 YPRERNEQSQKIFKFFDLMKVKYDDRLKQDLTGIQVFSSLHWPNYFLCSSKDYLALICTK 352 Query: 324 PHG 332 P+G Sbjct: 353 PYG 355
>VTS1_EMENI (Q5BGC4) Protein vts1| Length = 611 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 246 PKNVTSTWTGHDICATTSYLGFNCGAPHGQASNLTVTS 359 P NV ++W T+ G GAPH Q S++ + Sbjct: 332 PYNVNASWASMTNTPMTATFGSQLGAPHQQGSDMVANA 369
>RDRP_ORSVS (Q84133) RNA-directed RNA polymerase (EC 2.7.7.48) (183 kDa| protein) [Contains: Methyltransferase/RNA helicase (MT/HEL) (126 kDa protein)] Length = 1612 Score = 28.1 bits (61), Expect = 9.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 353 HREVTRLSMRCPA 315 HREV RLS+RCPA Sbjct: 949 HREVRRLSLRCPA 961
>RDRP_ORSVC (P89659) RNA-directed RNA polymerase (EC 2.7.7.48) (183 kDa| protein) [Contains: Methyltransferase/RNA helicase (MT/HEL) (126 kDa protein)] Length = 1612 Score = 28.1 bits (61), Expect = 9.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 353 HREVTRLSMRCPA 315 HREV RLS+RCPA Sbjct: 949 HREVRRLSLRCPA 961 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,918,825 Number of Sequences: 219361 Number of extensions: 1191864 Number of successful extensions: 3528 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 3390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3521 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)