| Clone Name | bast43e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TPIS_KLUMA (Q70JN8) Triosephosphate isomerase (EC 5.3.1.1) (TIM)... | 28 | 9.9 |
|---|
>TPIS_KLUMA (Q70JN8) Triosephosphate isomerase (EC 5.3.1.1) (TIM)| (Triose-phosphate isomerase) Length = 248 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 422 KIRDWLSACLAKPIAWATG-GLERDSAVLQAINHHV 318 K++DW + +A WA G GL S QAI+H + Sbjct: 153 KVQDWTNVVVAYEPVWAIGTGLAATSDDAQAIHHSI 188 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,025,795 Number of Sequences: 219361 Number of extensions: 486257 Number of successful extensions: 1881 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1865 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)