| Clone Name | bast43d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | XTH28_ARATH (Q38909) Probable xyloglucan endotransglucosylase/hy... | 45 | 7e-05 | 2 | XTH27_ARATH (Q8LDS2) Probable xyloglucan endotransglucosylase/hy... | 39 | 0.003 | 3 | XTH29_ARATH (Q8L7H3) Probable xyloglucan endotransglucosylase/hy... | 32 | 0.64 | 4 | XTH1_ARATH (Q9SV61) Putative xyloglucan endotransglucosylase/hyd... | 30 | 2.4 |
|---|
>XTH28_ARATH (Q38909) Probable xyloglucan endotransglucosylase/hydrolase protein| 28 precursor (EC 2.4.1.207) (At-XTH28) (XTH-28) Length = 332 Score = 44.7 bits (104), Expect = 7e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 41 FDEGYTQLFGSGNLALRREGKRVHLALDE 127 FDEGYTQLFG NL + R+GK V L LDE Sbjct: 31 FDEGYTQLFGDQNLIVHRDGKSVRLTLDE 59
>XTH27_ARATH (Q8LDS2) Probable xyloglucan endotransglucosylase/hydrolase protein| 27 precursor (EC 2.4.1.207) (At-XTH27) (XTH-27) Length = 333 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +2 Query: 38 AFDEGYTQLFGSGNLALRREGKRVHLALDE 127 +F+E YTQLFG NL + ++GK V L LDE Sbjct: 30 SFEESYTQLFGDKNLFVHQDGKSVRLTLDE 59
>XTH29_ARATH (Q8L7H3) Probable xyloglucan endotransglucosylase/hydrolase protein| 29 precursor (EC 2.4.1.207) (At-XTH29) (XTH-29) Length = 357 Score = 31.6 bits (70), Expect = 0.64 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 26 VRSMAFDEGYTQLFGSGNLALRREGKRVHLALDE 127 + + FDEG + LFG GNL + + V L LD+ Sbjct: 35 INPIFFDEGLSHLFGEGNLIRSPDDRSVRLLLDK 68
>XTH1_ARATH (Q9SV61) Putative xyloglucan endotransglucosylase/hydrolase protein| 1 precursor (EC 2.4.1.207) (At-XTH1) (XTH-1) Length = 295 Score = 29.6 bits (65), Expect = 2.4 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +2 Query: 14 LHGVVRS-MAFDEGYTQLFGSGNLALRREGKRVHLALDES 130 ++G+ +S + FD+ Y +G N+ +GK V L+LD S Sbjct: 29 VNGIDQSKVGFDDNYVVTWGQNNVLKLNQGKEVQLSLDHS 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,064,333 Number of Sequences: 219361 Number of extensions: 137000 Number of successful extensions: 552 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)