| Clone Name | bast43c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HDAC7_MOUSE (Q8C2B3) Histone deacetylase 7a (HD7a) | 29 | 7.1 |
|---|
>HDAC7_MOUSE (Q8C2B3) Histone deacetylase 7a (HD7a)| Length = 938 Score = 28.9 bits (63), Expect = 7.1 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 300 GEGSKDGQGTLLMSDHFVFPPSEHENLPIETALLEPQDSTSVDAAAAAFR 449 G G +G+G++ + H PP E ++L + P DS + A R Sbjct: 423 GRGPPEGRGSISLQQHQQVPPWEQQHLAGRLSQGSPGDSVLIPLAQVGHR 472 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,158,529 Number of Sequences: 219361 Number of extensions: 972873 Number of successful extensions: 2915 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2913 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)