| Clone Name | bast42g10 |
|---|---|
| Clone Library Name | barley_pub |
>MBD4_MOUSE (Q9Z2D7) Methyl-CpG-binding domain protein 4 (EC 3.2.2.-)| (Methyl-CpG-binding protein MBD4) (Mismatch-specific DNA N-glycosylase) Length = 554 Score = 36.6 bits (83), Expect = 0.025 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Frame = +3 Query: 252 PSGWTK----KLNTTRGGKFEVVFITPTGEQVKSKKALTTYL 365 P GW + +L+ GKF+V FI+P G + +SK++L YL Sbjct: 74 PCGWERVVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYL 115
>MECP2_MACFA (Q95LG8) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2)| Length = 486 Score = 34.7 bits (78), Expect = 0.094 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 252 PSGWTKKLNTTRGG----KFEVVFITPTGEQVKSKKALTTYLK 368 P GWT+KL + G K++V I P G+ +SK L Y + Sbjct: 101 PEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFE 143
>MECP2_HUMAN (P51608) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2)| Length = 486 Score = 34.7 bits (78), Expect = 0.094 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 252 PSGWTKKLNTTRGG----KFEVVFITPTGEQVKSKKALTTYLK 368 P GWT+KL + G K++V I P G+ +SK L Y + Sbjct: 101 PEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFE 143
>MECP2_RAT (Q00566) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2)| Length = 492 Score = 34.7 bits (78), Expect = 0.094 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 252 PSGWTKKLNTTRGG----KFEVVFITPTGEQVKSKKALTTYLK 368 P GWT+KL + G K++V I P G+ +SK L Y + Sbjct: 101 PEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFE 143
>MECP2_MOUSE (Q9Z2D6) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2)| Length = 484 Score = 34.7 bits (78), Expect = 0.094 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 252 PSGWTKKLNTTRGG----KFEVVFITPTGEQVKSKKALTTYLK 368 P GWT+KL + G K++V I P G+ +SK L Y + Sbjct: 101 PEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFE 143
>MBD4_HUMAN (O95243) Methyl-CpG-binding domain protein 4 (EC 3.2.2.-)| (Methyl-CpG-binding protein MBD4) (Methyl-CpG-binding endonuclease 1) (Mismatch-specific DNA N-glycosylase) Length = 580 Score = 33.1 bits (74), Expect = 0.27 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 252 PSGWTK----KLNTTRGGKFEVVFITPTGEQVKSKKALTTYL 365 P GW + +L G+F+V FI+P G + +SK +L YL Sbjct: 87 PCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYL 128
>MBD1_MOUSE (Q9Z2E2) Methyl-CpG-binding domain protein 1 (Methyl-CpG-binding| protein MBD1) Length = 636 Score = 30.8 bits (68), Expect = 1.4 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = +3 Query: 258 GWTKKLNTTRGG----KFEVVFITPTGEQVKSKKALTTYLKAHPGGPA 389 GW ++ + + G + ++ + +PTGE+++SK LT YL GPA Sbjct: 14 GWKRRESFRKSGASFGRSDIYYQSPTGEKIRSKVELTRYL-----GPA 56
>TOR_CAEEL (Q95Q95) Target of rapamycin homolog (EC 2.7.11.1) (CeTOR) (Lethal| protein 363) Length = 2697 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +1 Query: 22 RARGTQIQSPLSNPPHPSRIHTPPLXXXXXXXPKTRNSPE 141 R T + SP P P ++H PP+ P + SP+ Sbjct: 1940 RPHPTTVISPPQQPQQPKKMHIPPVTRATSPPPPAQKSPQ 1979
>PP2B1_CRYNV (O42773) Serine/threonine-protein phosphatase 2B catalytic subunit| A1 (EC 3.1.3.16) (Calcineurin A1) Length = 639 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 2 ANPKSQAEREELKSRAP--SPTLPTPRGSTLLPCGGGESGNPKLETAPS 142 A+P A EE+ S P SP TPR G G+P T+PS Sbjct: 519 ASPIMPATPEEIPSEIPYDSPITGTPRTPISSAIASGSPGSPGTPTSPS 567
>IF2_BIFLO (Q8G3Y5) Translation initiation factor IF-2| Length = 954 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +2 Query: 2 ANPKSQAEREELKSRAPSPTLPTPRGSTLLPCGGGESGNP 121 A P QA +AP+P PTPR P GG G P Sbjct: 84 AAPARQASPASAHQQAPTPGAPTPR-----PQGGARPGMP 118
>TULP1_HUMAN (O00294) Tubby-related protein 1 (Tubby-like protein 1)| Length = 542 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 38 KSRAPSPTLPTPRGSTLLPCGGGESGNPKLETAP 139 K R +P P P GS G G G P+ E +P Sbjct: 43 KKRTEAPESPCPTGSKPRKPGAGRRGRPREEPSP 76
>YHT1_YEAST (P38835) PH domain protein YHR131C| Length = 850 Score = 28.1 bits (61), Expect = 8.8 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 111 LSPPPQGRSVDPRGVGRVGEGALDLS-SSRSAC 16 + P PQ S+ G+ GE A DLS SSRS C Sbjct: 586 IRPKPQSSSIYLSGLAPNGESATDLSQSSRSLC 618 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,446,428 Number of Sequences: 219361 Number of extensions: 820375 Number of successful extensions: 3588 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3580 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)