ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast42g08 |
|---|---|
| Clone Library Name | barley_pub |
>U235_MOUSE (Q9CRC3) UPF0235 protein C15orf40 homolog| Length = 126 Score = 29.3 bits (64), Expect = 2.3 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 104 STSPGRPATSIGSVAPPQGG*EHADVGGDVHGYGTVALRRRPGVRR 241 +TS G+ T APP G V D G+ T+A+ +PG R+ Sbjct: 7 ATSKGKNQTKEPETAPPAAG----PVATDPKGFVTIAIHAKPGSRQ 48
>NCPR_SCHPO (P36587) NADPH--cytochrome P450 reductase (EC 1.6.2.4) (CPR)| (P450R) Length = 678 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 203 HTHARRLPHPHVLIRLEEAPHCQWTSR 123 H H ++PHP+ L E P WT + Sbjct: 488 HMHGEKIPHPNGLEYTLEGPRKNWTGK 514
>K1543_MOUSE (Q80VC9) Protein KIAA1543| Length = 1252 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 219 GDGRVFAEPLKSENENLKDFIQILEPENEKLK**QQFSQWQECAGDEARRSAAR 380 G G + + K E+E + +LE + +++ ++ QWQE ++ R AAR Sbjct: 882 GLGFFYKDEDKPEDEMAQKRASLLERQQRRVEEARRRKQWQEAEKEQKREEAAR 935
>CFAI_RAT (Q9WUW3) Complement factor I precursor (EC 3.4.21.45) (C3B/C4B| inactivator) [Contains: Complement factor I heavy chain; Complement factor I light chain] Length = 604 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 340 CHWENC-CYHLSFSFSGSKICIKSFKFSFSLFRGSANT 230 CH ++ C H FS + C KF+ SL GS +T Sbjct: 89 CHLKSFECLHPEIKFSNNGTCTAEEKFNVSLIYGSTDT 126
>STRK_STRGR (P09401) Streptomycin-6-phosphate phosphatase precursor (EC| 3.1.3.39) Length = 449 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +2 Query: 59 TSPPAARGWRL*ARCST-SPGRPA 127 T PPAA G RC+T +PGRPA Sbjct: 263 TGPPAAPGGTAPQRCATRNPGRPA 286
>KREM1_HUMAN (Q96MU8) Kremen protein 1 precursor (Kringle-containing protein| marking the eye and the nose) (Kringle domain-containing transmembrane protein 1) (Dickkopf receptor) Length = 475 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +2 Query: 62 SPPAARGWRL*ARCSTSPGRPATSI---GSVAPPQGG*EHADVGGDVHGYGTVAL 217 S AAR ++ +TSP P ++ S APP G H G V+G T+ + Sbjct: 349 SVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWTVYGLATLLI 403
>BRWD1_HUMAN (Q9NSI6) Bromodomain and WD-repeat domain-containing protein 1| (WD-repeat protein 9) Length = 2320 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 231 VFAEPLKSENENLKDFIQILEPENEKLK**QQFSQWQECAGDEARRSAARD 383 +F E +K + + K I + NEKL+ Q+F Q Q C GD + R+ Sbjct: 1410 LFEEKMKKISSDFK----IGQKFNEKLRRSQRFKQRQNCKGDSQPNKSIRN 1456
>Y489_MYCPN (P75296) Hypothetical lipoprotein MG338 homolog precursor| (P02_orf1300) Length = 1300 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 231 VFAEPLKSENENLKDFIQILEPENEKLK**QQFSQW 338 +F+E ++ E++NL D Q EP N ++ +++ QW Sbjct: 100 IFSENVEDEHDNLLDQKQQAEPINWPIELQKEYDQW 135
>PER1_RAT (Q8CHI5) Period circadian protein 1 (rPER1) (Fragment)| Length = 1244 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 378 EQRSAAPHRPRTLATGKIAAIT*ASRSPAP 289 E R+ P RPR LATG A +SP P Sbjct: 566 ESRAKPPPRPRLLATGTFKAKVLPCQSPNP 595
>PER1_MOUSE (O35973) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (mPER) (M-Rigui) Length = 1291 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 378 EQRSAAPHRPRTLATGKIAAIT*ASRSPAP 289 E R+ P RPR LATG A +SP P Sbjct: 566 ESRAKPPPRPRLLATGTFKAKVLPCQSPNP 595
>GFI1_HUMAN (Q99684) Zinc finger protein Gfi-1 (Growth factor independence 1)| Length = 422 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -1 Query: 289 KICIKSFKFSFSLFRG---SANTRPSPQGYCAIPMHVASHIR 173 KIC KSFK S +L ++TRP P YC H S ++ Sbjct: 315 KICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMK 356
>GFI1_CANFA (Q5DWN0) Zinc finger protein Gfi-1 (Growth factor independence 1)| Length = 422 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -1 Query: 289 KICIKSFKFSFSLFRG---SANTRPSPQGYCAIPMHVASHIR 173 KIC KSFK S +L ++TRP P YC H S ++ Sbjct: 315 KICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMK 356
>GFI1_RAT (Q07120) Zinc finger protein Gfi-1 (Growth factor independence 1)| Length = 423 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -1 Query: 289 KICIKSFKFSFSLFRG---SANTRPSPQGYCAIPMHVASHIR 173 KIC KSFK S +L ++TRP P YC H S ++ Sbjct: 316 KICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMK 357
>GFI1_MOUSE (P70338) Zinc finger protein Gfi-1 (Growth factor independence 1)| Length = 423 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -1 Query: 289 KICIKSFKFSFSLFRG---SANTRPSPQGYCAIPMHVASHIR 173 KIC KSFK S +L ++TRP P YC H S ++ Sbjct: 316 KICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMK 357
>PFA4_EMENI (Q5BD15) Palmitoyltransferase pfa4 (EC 2.3.1.-) (Protein fatty| acyltransferase 4) Length = 435 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +2 Query: 20 RTAGRWRWCRRWRT-SPPAARGWRL*ARC 103 R +GR RWCRR PP A + RC Sbjct: 85 RASGRQRWCRRCEAYKPPRAHHCKTCERC 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,283,160 Number of Sequences: 219361 Number of extensions: 978129 Number of successful extensions: 2825 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2817 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
