| Clone Name | bast42g02 |
|---|---|
| Clone Library Name | barley_pub |
>EID1_ARATH (Q8LEA8) Phytochrome A-associated F-box protein (Empfindlicher im| dunkelroten Licht protein 1) Length = 336 Score = 37.7 bits (86), Expect = 0.014 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +3 Query: 384 HKMSVCCPGLLRAGILLEPTDDFGL 458 +K++VCCPGL AGILLE DFGL Sbjct: 93 YKLAVCCPGLFHAGILLE-NSDFGL 116
>ENDR_BOVIN (P07106) Endozepine-related protein precursor (Membrane-associated| diazepam-binding inhibitor) (MA-DBI) Length = 533 Score = 29.6 bits (65), Expect = 3.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 24 ARTVSSAATHQPPRKQERDAGRTAAMSAAEHKDMEIAV 137 A + AA P R + RD+ + +A+HK++EI V Sbjct: 199 AESEEEAAQEDPKRPEPRDSDKKMMKKSADHKNLEIIV 236
>IE63_MCMVS (Q69154) Transcriptional regulator IE63 homolog (Protein UL69)| Length = 841 Score = 29.3 bits (64), Expect = 5.0 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 8 ASHPNSPNGQQRSHSSATKKAGARRGPHRSHERRGAQGH 124 ++H +S +G +R SSAT +RRG R +R + GH Sbjct: 527 STHDSSSSGSRR-RSSATDGRRSRRGSRRGEAQRESNGH 564
>ELOA3_HUMAN (Q8NG57) RNA polymerase II transcription factor SIII subunit A3| (Elongin A3) (EloA3) (Transcription elongation factor B polypeptide 3C) Length = 546 Score = 28.5 bits (62), Expect = 8.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 14 HPNSPNGQQRSHSSATKKAGARRGPHRSHERRGA 115 HP SP+ + R+ + A A GPHR R A Sbjct: 143 HPRSPSREPRAERKRPRMAPADSGPHRDPPTRTA 176
>LMO6_MOUSE (Q80VL3) LIM domain only protein 6 (Triple LIM domain protein 6)| Length = 624 Score = 28.5 bits (62), Expect = 8.6 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = +2 Query: 17 PNSPNGQQRSHSSATKKAGARRGPHRSHERRGAQGH 124 P +P+ H ++ RRG H H G GH Sbjct: 505 PRTPSCHHHHHHRRRRQRHRRRGSHHHHHHPGRHGH 540 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,470,261 Number of Sequences: 219361 Number of extensions: 326580 Number of successful extensions: 1223 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1222 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)