| Clone Name | bast42f07 |
|---|---|
| Clone Library Name | barley_pub |
>MBD2_HUMAN (Q9UBB5) Methyl-CpG-binding domain protein 2 (Methyl-CpG-binding| protein MBD2) (Demethylase) (DMTase) Length = 411 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -3 Query: 127 PRSEQ-PYQKEQRRPSPRAPGQLEPASRRRCRRLPPEW 17 PR E P+ P PR P E R C LPP W Sbjct: 122 PRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGW 159
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 30.4 bits (67), Expect = 1.9 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -3 Query: 154 AAAGRRCRLPRSEQPYQKEQRRPSPRAPGQLEPASRRRCRRLPPE 20 ++ GR R RS QP ++ P PRAP P RR P+ Sbjct: 683 SSPGRSTREARSPQPNKRHSPSPRPRAPQTSSPPPVRRGASASPQ 727
>MBD2_MOUSE (Q9Z2E1) Methyl-CpG-binding domain protein 2 (Methyl-CpG-binding| protein MBD2) Length = 414 Score = 30.4 bits (67), Expect = 1.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 124 RSEQPYQKEQRRPSPRAPGQLEPASRRRCRRLPPEW 17 R P+ P PR P E R C LPP W Sbjct: 127 RDPVPFPSGSSGPGPRGPRATESGKRMDCPALPPGW 162
>TNR6A_HUMAN (Q8NDV7) Trinucleotide repeat-containing gene 6A protein (CAG| repeat protein 26) (Glycin-tryptophan protein of 182 kDa) (GW182 autoantigen) (GW1 protein) (EMSY interactor protein) Length = 1962 Score = 28.9 bits (63), Expect = 5.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 127 PRSEQPYQKEQRRPSPRAPGQLEPASRRRCRRLPPEW 17 P+ +QP Q+ Q +P + P Q A R R +PP + Sbjct: 104 PQQQQPQQQPQPQPQQQQPQQQPQALPRYPREVPPRF 140
>AMELX_HUMAN (Q99217) Amelogenin, X isoform precursor| Length = 191 Score = 28.5 bits (62), Expect = 7.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 127 PRSEQPYQKEQRRPSPRAPGQLEPASRRRCRRLPPEWP 14 P ++QPYQ + +P P P Q +P + LPP+ P Sbjct: 121 PPAQQPYQPQPVQPQPHQPMQPQPPV-HPMQPLPPQPP 157
>PAIP1_HUMAN (Q9H074) Polyadenylate-binding protein-interacting protein 1| (Poly(A)-binding protein-interacting protein 1) (PABP-interacting protein 1) (PAIP-1) Length = 479 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 127 PRSEQPYQKEQRRP-SPRAPGQLEPASRRRCRRLPP 23 P P ++ + +P P+APG L+P R+ R PP Sbjct: 32 PNGAGPAERARHQPPQPKAPGFLQPPPLRQPRTTPP 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,639,778 Number of Sequences: 219361 Number of extensions: 367917 Number of successful extensions: 1359 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1355 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)