| Clone Name | bast42f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLIT1_MOUSE (Q80TR4) Slit homolog 1 protein precursor (Slit-1) | 29 | 5.1 | 2 | NHR11_CAEEL (Q23294) Nuclear hormone receptor family member nhr-11 | 28 | 8.7 | 3 | FRP1_SCHPO (Q04800) Ferric reductase transmembrane component (EC... | 28 | 8.7 |
|---|
>SLIT1_MOUSE (Q80TR4) Slit homolog 1 protein precursor (Slit-1)| Length = 1531 Score = 29.3 bits (64), Expect = 5.1 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +3 Query: 255 VAHSCLCRKNIAHMDLSRLVAMAVLLGALQPLLSHC-AGDVKGLHPVVLVPEYGSNLLE 428 +A+SC C+ + +++ A+A G LQ L HC A KG H V P + L E Sbjct: 1394 LAYSCQCQDGYSGALCNQVGAVAEPCGGLQCLHGHCQASATKGAH-CVCSPGFSGELCE 1451
>NHR11_CAEEL (Q23294) Nuclear hormone receptor family member nhr-11| Length = 459 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 195 GGKCFRSCSSFINPRISPLTMKYEC 121 GG+C ++C++F I+ L +KYEC Sbjct: 19 GGRCCKACAAFFRRTIA-LDLKYEC 42
>FRP1_SCHPO (Q04800) Ferric reductase transmembrane component (EC 1.16.1.7)| (Ferric-chelate reductase) Length = 564 Score = 28.5 bits (62), Expect = 8.7 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 207 SQFFGTKNNTAPLLLLVAHSCLCRKNIAHMDLSRLVAMAVLLGAL 341 S FF KNN LLL+ +H + N H LS+ A+++GA+ Sbjct: 132 SYFFSIKNNPFALLLISSHE---KMNYVHRRLSQ---YAIMIGAI 170 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,555,162 Number of Sequences: 219361 Number of extensions: 1158021 Number of successful extensions: 2873 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2873 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)