| Clone Name | bast42b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRPH_MESAU (P06680) Acidic proline-rich protein HP43A precursor | 32 | 0.70 | 2 | RS10B_ARATH (Q9FFS8) 40S ribosomal protein S10-2 | 30 | 2.7 | 3 | HORN_HUMAN (Q86YZ3) Hornerin | 29 | 5.9 | 4 | IF2_CARHZ (Q3AB98) Translation initiation factor IF-2 | 29 | 5.9 | 5 | BSN_RAT (O88778) Bassoon protein | 28 | 7.7 | 6 | IF2_PROMM (Q7V5M4) Translation initiation factor IF-2 | 28 | 7.7 |
|---|
>PRPH_MESAU (P06680) Acidic proline-rich protein HP43A precursor| Length = 183 Score = 32.0 bits (71), Expect = 0.70 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -2 Query: 226 EPDGERRGGQRDGVEQQHGEHGAL-----AQEQHLPQRQGEGKARPPFP 95 + DGE G +G QQ G+H +Q PQ++G+ + RPP P Sbjct: 57 DDDGEEDGNAPEGPPQQGGDHQKPRPPKPGNQQGPPQQEGQQQNRPPKP 105
>RS10B_ARATH (Q9FFS8) 40S ribosomal protein S10-2| Length = 180 Score = 30.0 bits (66), Expect = 2.7 Identities = 24/56 (42%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = -2 Query: 241 PVAPREPDGERRGGQRDGVE---QQHGEHG--ALAQEQHLPQ-RQGEGKARPPFPR 92 P P DGERR G RDG + GE+G A A + P R G G AR F R Sbjct: 110 PRGPPRGDGERRFGDRDGYRGGPKSGGEYGDKAGAPADYQPGFRGGAGGARQGFGR 165
>HORN_HUMAN (Q86YZ3) Hornerin| Length = 2850 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 217 GERRGGQRDGVEQQHGEHGALAQEQHLPQRQGEGKARPPFPRR 89 GER+G G +G+HG+ +++ R G G + P P R Sbjct: 504 GERQGSSA-GSSSSYGQHGSGSRQSLGHSRHGSGSGQSPSPSR 545
>IF2_CARHZ (Q3AB98) Translation initiation factor IF-2| Length = 827 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = -2 Query: 232 PREPDGERRGGQRDGVEQQH--GEHGALAQEQHL--PQRQGEGKARPPFPR 92 PR+ D RR G++ Q + +E+ + P+ GE K RPPFPR Sbjct: 118 PRDKDKGRRPGEQRSFNQNRPRDDRRRFDKERGVQGPKPFGEKKERPPFPR 168
>BSN_RAT (O88778) Bassoon protein| Length = 3937 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 360 SASMTGHLYPV*PSAAEPSTSRTQLPLKTSQPLGPGRTSR 241 S S T H Y P+ A + +LP S P G GR SR Sbjct: 1403 STSSTIHSYGQPPTTANYGSQTEELPHAPSGPAGSGRASR 1442
>IF2_PROMM (Q7V5M4) Translation initiation factor IF-2| Length = 1125 Score = 28.5 bits (62), Expect = 7.7 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = -2 Query: 247 VAPVAPREPDGERRGGQRDGVEQQHGEHGALAQEQHLPQRQG----EGKARPPFPR 92 VAP + +P+G+R +R G+ + G Q + QR G +GK RP PR Sbjct: 255 VAPPSRPDPEGQRPDKKRPGISPR--PIGGPNQRANTSQRPGAPIRQGKTRPGQPR 308 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,160,714 Number of Sequences: 219361 Number of extensions: 869942 Number of successful extensions: 3259 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3250 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)