| Clone Name | bast42a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TSJT1_TOBAC (P24805) Stem-specific protein TSJT1 | 68 | 1e-11 |
|---|
>TSJT1_TOBAC (P24805) Stem-specific protein TSJT1| Length = 149 Score = 67.8 bits (164), Expect = 1e-11 Identities = 34/112 (30%), Positives = 54/112 (48%) Frame = +1 Query: 136 MLAVFDQTVAKCPEGLRSPPXXXXXXXXXXXXXLMKGFADANDAAVTVXXXXXXXXXXXX 315 MLAVF+Q++ + P L P + + F + Sbjct: 1 MLAVFEQSIGRPPPELSLPQAGIQKKEAKTREEIAESFKTWKQDSTFYHLFNGNFMAFSH 60 Query: 316 XNKNPLVPRMFGSVNDIFCLFQGHVENIGHLKQHYGLSKTANEVTILIEAYR 471 N+NPL PR ++D+FC+F G ++N L++HYGLS+ A E I++EAY+ Sbjct: 61 GNENPLQPRSIVVMDDVFCIFSGALDNTFDLRKHYGLSRQATEAMIMVEAYK 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,893,266 Number of Sequences: 219361 Number of extensions: 504183 Number of successful extensions: 974 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)