| Clone Name | bast42a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PUTP_SALTY (P10502) Sodium/proline symporter (Proline permease) | 30 | 2.3 | 2 | PUTP_HAEIN (P45174) Sodium/proline symporter (Proline permease) | 30 | 2.3 | 3 | PUTP_ECOLI (P07117) Sodium/proline symporter (Proline permease) | 30 | 2.9 | 4 | YC9D_SCHPO (Q09887) Putative amino-acid permease C584.13 | 29 | 5.0 | 5 | FOXE3_MOUSE (Q9QY14) Forkhead box protein E3 | 29 | 6.6 |
|---|
>PUTP_SALTY (P10502) Sodium/proline symporter (Proline permease)| Length = 502 Score = 30.4 bits (67), Expect = 2.3 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +3 Query: 354 LLMPWVAGVALLFGFAGVISTLSSGLLPFSS 446 L PW+AGV L A V+STLS LL SS Sbjct: 321 LFNPWIAGVLLSAILAAVMSTLSCQLLVCSS 351
>PUTP_HAEIN (P45174) Sodium/proline symporter (Proline permease)| Length = 504 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 354 LLMPWVAGVALLFGFAGVISTLSSGLLPFSS 446 L PW+AG+ L A V+STLS+ LL SS Sbjct: 325 LFNPWIAGILLSAILAAVMSTLSAQLLISSS 355
>PUTP_ECOLI (P07117) Sodium/proline symporter (Proline permease)| Length = 502 Score = 30.0 bits (66), Expect = 2.9 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 354 LLMPWVAGVALLFGFAGVISTLSSGLLPFSS 446 L PW+AG+ L A V+STLS LL SS Sbjct: 321 LFNPWIAGILLSAILAAVMSTLSCQLLVCSS 351
>YC9D_SCHPO (Q09887) Putative amino-acid permease C584.13| Length = 544 Score = 29.3 bits (64), Expect = 5.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 366 WVAGVALLFGFAGVISTLSSGLLPFSSPASC 458 W G+A+L FAGVI T+S PF C Sbjct: 240 WSNGMAMLMSFAGVIWTMSGYDSPFHLSEEC 270
>FOXE3_MOUSE (Q9QY14) Forkhead box protein E3| Length = 288 Score = 28.9 bits (63), Expect = 6.6 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -3 Query: 451 AGEEKGRRPEERVEMTPAKPKSSATPATHGMRRKPMANVTDPH 323 AG E GR PEE V A+P +A P RR+P+ P+ Sbjct: 27 AGAEPGREPEEVVGGGDAEP--TAVPGPGKRRRRPLQRGKPPY 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.128 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,079,835 Number of Sequences: 219361 Number of extensions: 428105 Number of successful extensions: 1533 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1527 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)