| Clone Name | bast41h03 |
|---|---|
| Clone Library Name | barley_pub |
>LGT_CITUN (Q9MB73) Limonoid UDP-glucosyltransferase (EC 2.4.1.210) (Limonoid| glucosyltransferase) (Limonoid GTase) (LGTase) Length = 511 Score = 37.7 bits (86), Expect = 0.013 Identities = 23/103 (22%), Positives = 46/103 (44%) Frame = +1 Query: 127 HFLVVTYPAQGHINPXXXXXXXXXXXTPGARVTVSTAVSACRKMFPXXXXXXXXXXXXXX 306 H L+V++P GH+NP + G +T++T S ++M Sbjct: 8 HVLLVSFPGHGHVNP--LLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDG 65 Query: 307 GVRYVPYSDGYDGGFDKSAHDSTDYMSNLKVVGARTLDGVLAR 435 +R+ + DG+D D D YM+ L+++G + + ++ + Sbjct: 66 FIRFEFFEDGWDED-DPRREDLDQYMAQLELIGKQVIPKIIKK 107
>GRN_RAT (P23785) Granulins precursor [Contains: Acrogranin; Granulin-1| (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B) (Epithelin-2); Granulin-4 (Granulin A) (Epithelin-1); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Gran Length = 588 Score = 33.5 bits (75), Expect = 0.24 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 102 GRHCCVRAMRCECKKTRAYQVSKSVLTGVGCGGS 1 G+HCC R C Q+S S+L V C GS Sbjct: 95 GQHCCPRGFHCSADGKSCSQISDSLLGAVQCPGS 128
>COGT2_ARATH (Q9SK82) Cytokinin-O-glucosyltransferase 2 (EC 2.4.1.-) (Zeatin| O-glucosyltransferase 2) Length = 489 Score = 32.3 bits (72), Expect = 0.54 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 118 EAPHFLVVTYPAQGHINP 171 + PH + V YPAQGHINP Sbjct: 10 QKPHVVCVPYPAQGHINP 27
>IAAG_MAIZE (Q41819) Indole-3-acetate beta-glucosyltransferase (EC 2.4.1.121)| (IAA-Glu synthetase) ((Uridine 5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl transferase) Length = 471 Score = 32.3 bits (72), Expect = 0.54 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 Query: 121 APHFLVVTYPAQGHINP 171 APH LVV +P QGH+NP Sbjct: 2 APHVLVVPFPGQGHMNP 18
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 29.6 bits (65), Expect = 3.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 102 GRHCCVRAMRCECKKTRAYQVSKSVLTGVGCGGS 1 G HCC + C +Q+S + L V C GS Sbjct: 95 GYHCCPQGFHCSADGKSCFQMSDNPLGAVQCPGS 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,833,965 Number of Sequences: 219361 Number of extensions: 477529 Number of successful extensions: 1287 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1287 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)