| Clone Name | bast41e07 |
|---|---|
| Clone Library Name | barley_pub |
>MDR49_DROME (Q00449) Multidrug resistance protein homolog 49 (EC 3.6.3.44)| (P-glycoprotein 49) Length = 1302 Score = 30.8 bits (68), Expect = 0.94 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +1 Query: 97 LACRCKMRSRG--FALSHAAVFLAWWMVHCGGGLVAA 201 +ACR K+R RG FAL AA FLA+ + GG++ A Sbjct: 952 VACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVA 988
>RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1846 Score = 30.4 bits (67), Expect = 1.2 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 166 TTRETPRHGSEQSHGSSSCTGKLASAELCSPA--SCAQTRPSSQLRLPLTS 20 T R HG + LASA C PA SC RPS ++R PL S Sbjct: 1052 TVRTMSPHGESSDSIPAPVAPALASA--CQPARMSCLSPRPSPEVRTPLAS 1100
>RIMB1_RAT (Q9JIR0) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (RIM-binding protein 1) (RIM-BP1) Length = 1847 Score = 30.0 bits (66), Expect = 1.6 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 166 TTRETPRHGSEQSHGSSSCTGKLASAELCSPA--SCAQTRPSSQLRLPLTS 20 T R HG + LASA C PA SC RPS ++R PL S Sbjct: 1054 TVRTMSPHGESTDSIPAPVAPALASA--CQPARMSCLSPRPSPEVRTPLAS 1102
>HLES_DROME (Q02308) Protein hairless| Length = 1077 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 78 EQSSALASLPVQDEEPWLCSEPCRGVSR 161 + +S++ S P Q ++PW S P RG+S+ Sbjct: 300 DDNSSIQSSPWQRDQPWKQSRPRRGISK 327
>PO3F1_RAT (P20267) POU domain, class 3, transcription factor 1| (Octamer-binding transcription factor 6) (Oct-6) (POU-domain transcription factor SCIP) (Tst-1) Length = 451 Score = 27.7 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = -3 Query: 266 AGSG*P-LQSVWAV*SYQPSGGTA----ATSPPPQCTIHH 162 AG+G P + V+A P GG+A A PPP +HH Sbjct: 401 AGAGHPPMDDVYAPGELGPGGGSASPPSAPPPPPPAALHH 440
>PO3F1_MOUSE (P21952) POU domain, class 3, transcription factor 1| (Octamer-binding transcription factor 6) (Oct-6) (POU-domain transcription factor SCIP) Length = 449 Score = 27.7 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = -3 Query: 266 AGSG*P-LQSVWAV*SYQPSGGTA----ATSPPPQCTIHH 162 AG+G P + V+A P GG+A A PPP +HH Sbjct: 399 AGAGHPPMDDVYAPGELGPGGGSASPPSAPPPPPPAALHH 438
>RIMB1_HUMAN (O95153) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1857 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -1 Query: 145 HGSEQSHGSSSCTGKLASAELCSPASCAQTRPSSQLRLPLTS 20 HG + T LA A L + SC PS + R PL S Sbjct: 1063 HGESADSIPAPITPALAPASLPARVSCPSPHPSPEARAPLAS 1104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,041,825 Number of Sequences: 219361 Number of extensions: 799155 Number of successful extensions: 2868 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2864 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)