| Clone Name | bast41e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 p... | 43 | 2e-04 |
|---|
>AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 precursor| Length = 252 Score = 42.7 bits (99), Expect = 2e-04 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +1 Query: 223 YAKCEDLPQLGAALHWTYDESKSSLSLAFVA 315 + CEDLP L + LH+TY+ S SSLS+AFVA Sbjct: 40 FDSCEDLPVLNSYLHYTYNSSNSSLSVAFVA 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,796,457 Number of Sequences: 219361 Number of extensions: 246143 Number of successful extensions: 887 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)