| Clone Name | bast41d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MBB1A_HUMAN (Q9BQG0) Myb-binding protein 1A | 28 | 6.9 | 2 | DP13B_MOUSE (Q8K3G9) DCC-interacting protein 13 beta (Dip13 beta... | 27 | 9.0 | 3 | GLPK1_SULAC (Q4J9R1) Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer... | 27 | 9.0 | 4 | YO13_CAEEL (P34669) Hypothetical protein ZK686.3 in chromosome III | 27 | 9.0 |
|---|
>MBB1A_HUMAN (Q9BQG0) Myb-binding protein 1A| Length = 1328 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 165 SSLQQLASKKRKDHGYLPSLAWYCTKEKKRQRTRKG 58 S+ Q SKKRK G+LP TK++K++++ G Sbjct: 1159 SATQSPISKKRKKKGFLPE-----TKKRKKRKSEDG 1189
>DP13B_MOUSE (Q8K3G9) DCC-interacting protein 13 beta (Dip13 beta) (Adapter| protein containing PH domain, PTB domain and leucine zipper motif 2) Length = 662 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 159 LQQLASKKRKDHGYLPSLAWYCTKEKKRQRTRKGMMD 49 ++++A+ +RK H L SL +YC + R R MM+ Sbjct: 164 VKEVAAARRKQH--LSSLQYYCALNALQYRKRAAMME 198
>GLPK1_SULAC (Q4J9R1) Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol| 3-phosphotransferase 1) (Glycerokinase 1) (GK 1) Length = 498 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -2 Query: 168 YSSLQQLASKKRKDHGYLPSLAWYCTKEKKRQRTRKG 58 +SSL++L SK D ++PSL +E +R+R KG Sbjct: 448 WSSLEELKSKWAVDREFIPSL-----QEDRRERLYKG 479
>YO13_CAEEL (P34669) Hypothetical protein ZK686.3 in chromosome III| Length = 331 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 2/24 (8%) Frame = +2 Query: 74 CLFFSFVQ--YQAKLGRYPWSFLF 139 C+FFSF+ +++K YP+SFLF Sbjct: 307 CVFFSFLLSVFRSKYRGYPYSFLF 330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,750,699 Number of Sequences: 219361 Number of extensions: 607191 Number of successful extensions: 1828 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1828 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)