| Clone Name | bast41c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I | 36 | 0.040 | 2 | IMPX_YEAST (P32351) Sugar utilization regulatory protein IMP2 | 29 | 6.4 | 3 | HNF1_SALSA (Q91474) Hepatocyte nuclear factor 1 (HNF-1) (SHNF1) | 29 | 6.4 |
|---|
>YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I| Length = 601 Score = 36.2 bits (82), Expect = 0.040 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +3 Query: 279 FSSLAASSSPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHV 419 F + A+SS + + +DLS ES A +WAV LR GD ++++ V Sbjct: 420 FQTAASSSKRNCTYFLTLDLSSESLHAAEWAVGILLRNGDTLIIVDV 466
>IMPX_YEAST (P32351) Sugar utilization regulatory protein IMP2| Length = 346 Score = 28.9 bits (63), Expect = 6.4 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 294 ASSSPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPT 428 A + R + DLS ES +A+ + + + GD V ++H P+ Sbjct: 204 AEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPS 248
>HNF1_SALSA (Q91474) Hepatocyte nuclear factor 1 (HNF-1) (SHNF1)| Length = 559 Score = 28.9 bits (63), Expect = 6.4 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +1 Query: 4 SPNPISILGKTLDLVPPSFPD---PPHQIESSTA 96 SP+P+ + L L PPS PPH++ SS A Sbjct: 511 SPSPVPVSSGNLQLYPPSQSSESHPPHRLSSSPA 544 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,805,876 Number of Sequences: 219361 Number of extensions: 446390 Number of successful extensions: 1710 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1710 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)