| Clone Name | bast41b08 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC1_RAT (Q07008) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 109 WLPRVRRGGIPGQWSLLAPGIS 174 WLPR++ G +P Q++ L PG++ Sbjct: 2300 WLPRLQNGMVPSQYNPLRPGVT 2321
>NOTC1_MOUSE (Q01705) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| (Motch A) (mT14) (p300) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 109 WLPRVRRGGIPGQWSLLAPGIS 174 WLPR++ G +P Q++ L PG++ Sbjct: 2300 WLPRLQNGMVPSQYNPLRPGVT 2321
>PPDK_GIALA (P51776) Pyruvate, phosphate dikinase (EC 2.7.9.1) (Pyruvate,| orthophosphate dikinase) Length = 884 Score = 29.6 bits (65), Expect = 3.8 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 300 AEPVGRLERHVHQRVEELHQ 241 AE + + RH+H+RVE+LH+ Sbjct: 647 AEDMNKKHRHIHERVEDLHE 666
>MNTH_STAES (Q8CPM6) Probable manganese transport protein mntH| Length = 453 Score = 29.3 bits (64), Expect = 5.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 37 QFFTTTQNLVCPQSTRTWMLLLSWWLPRVRRG 132 Q T+ QNL+ P +TW+ ++SW L V G Sbjct: 409 QLATSNQNLMGPFKNKTWINIISWLLIIVLSG 440
>MNTH_STAEQ (Q5HQ64) Probable manganese transport protein mntH| Length = 453 Score = 29.3 bits (64), Expect = 5.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 37 QFFTTTQNLVCPQSTRTWMLLLSWWLPRVRRG 132 Q T+ QNL+ P +TW+ ++SW L V G Sbjct: 409 QLATSNQNLMGPFKNKTWINIISWLLIIVLSG 440 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,859,398 Number of Sequences: 219361 Number of extensions: 671890 Number of successful extensions: 2316 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2310 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)