| Clone Name | bast41b07 |
|---|---|
| Clone Library Name | barley_pub |
>LRP1_HHV1F (P17588) Latency-related protein 1| Length = 340 Score = 33.9 bits (76), Expect = 0.11 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 35 PDPTHTHTHAPNAP-APLVSYQSRPTDTLRRAPPPNGRH 148 P PTH H+HAP P P S+ L RAP P H Sbjct: 27 PTPTHPHSHAPPLPRTPTPSHPHSRAPPLPRAPTPTHPH 65 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 35 PDPTHTHTHAPNAPAPLVSYQSRPTDTLRR 124 P PTH H+HAP P + + PT T +R Sbjct: 59 PTPTHPHSHAPPLPR---TPEIHPTQTGKR 85
>VG42_BPMU (Q9T1V6) Protein gp42| Length = 690 Score = 32.0 bits (71), Expect = 0.43 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -2 Query: 132 GGALRSVSVGRLW*LTRGAGALGAWVWVWVGSGRALS 22 G L ++GR+ +T+GAGALG W+ G+GRALS Sbjct: 531 GNKLAGSAIGRV--VTKGAGALG---WMGKGAGRALS 562
>LRP2_HHV1F (P17589) Latency-related protein 2| Length = 107 Score = 31.2 bits (69), Expect = 0.73 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 35 PDPTHTHTHAPNAP-APLVSYQSRPTDTLRRAPPPNGRH 148 P PTH H+HAP P P ++ L R P P H Sbjct: 9 PTPTHPHSHAPPLPRTPTPAHPHSHAPPLPRTPTPTHPH 47
>SIF2_DROME (P91620) Protein still life, isoforms C/SIF type 2| Length = 2061 Score = 29.6 bits (65), Expect = 2.1 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 25 QSSARSHPHPHPRTQCARAPRELPEPTDR 111 Q A +HPHPHP PRE P P R Sbjct: 1930 QGHAHAHPHPHPH------PREPPPPPIR 1952
>YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region| Length = 153 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 10 PVVTTQSSARSHPHPHPRTQCARAPRELPEPTDRHTAQSTTT 135 P T + PHPHP T P P PT HT TT Sbjct: 33 PTHTHPHTPTPTPHPHPHTP---HPHTTPTPTPHHTHTPHTT 71
>SIF1_DROME (P91621) Protein still life, isoform SIF type 1| Length = 2072 Score = 29.6 bits (65), Expect = 2.1 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 25 QSSARSHPHPHPRTQCARAPRELPEPTDR 111 Q A +HPHPHP PRE P P R Sbjct: 1941 QGHAHAHPHPHPH------PREPPPPPIR 1963
>TCRG1_HUMAN (O14776) Transcription elongation regulator 1 (TATA box-binding| protein-associated factor 2S) (Transcription factor CA150) Length = 1098 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = +1 Query: 1 ISVPVVTTQSSARSH------PHPHPRTQCARAPRELPEPT 105 ++ P V+ + AR+ P PHP+T P +P+PT Sbjct: 312 VATPTVSVSTPARTATPVQTVPQPHPQTLPPAVPHSVPQPT 352
>YEI4_YEAST (P39973) Hypothetical UPF0320 protein YEL074W| Length = 112 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 44 THTHTHAPNAPAPLVSYQSRPTDTLRRAPPPNGRH 148 THTHTH P +P+ + +Y +T ++P + +H Sbjct: 72 THTHTHTPCSPSLVYTY----VNTTEKSPSKSPKH 102
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 28 SSARSHPHPHPRTQCARAPRELPEP 102 S SHPHPHP + P P+P Sbjct: 218 SHPHSHPHPHPHPHPHQIPHPHPQP 242
>DAPA1_WHEAT (P24846) Dihydrodipicolinate synthase 1, chloroplast precursor (EC| 4.2.1.52) (DHDPS 1) Length = 388 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 37 RSHPHPHPRTQCARAPRELPEP 102 R HPHPHP ++ +RA P P Sbjct: 8 RPHPHPHPTSRLSRASPPSPFP 29
>BRSK2_HUMAN (Q8IWQ3) BR serine/threonine-protein kinase 2 (EC 2.7.11.1)| (Serine/threonine-protein kinase 29) (SAD1B) Length = 736 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +1 Query: 1 ISVPVVTTQSSARSHPHPHPRTQCARAPRELPEPTDRHTAQST-TTERTPW 150 +S P VT S R P P P+ P+E P T T S+ + PW Sbjct: 425 LSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPW 475
>LDB3_HUMAN (O75112) LIM domain-binding protein 3 (Z-band alternatively spliced| PDZ-motif protein) (Protein cypher) Length = 727 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 35 PDPTHTHTHAPNA-PAPLVSYQSRPTDTLRRAP 130 P P +T + APN PAP V+Y P + R P Sbjct: 457 PAPAYTPSPAPNYNPAPSVAYSGGPAEPASRPP 489
>ZN759_MOUSE (Q80VM4) Zinc finger protein 579| Length = 562 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 52 PHPRTQCARAPRELPEPTD--RHTAQ 123 P P +CA PR PEP RH AQ Sbjct: 98 PQPPLRCAACPRTFPEPAQLRRHLAQ 123
>ZN759_HUMAN (Q8NAF0) Zinc finger protein 579| Length = 562 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 52 PHPRTQCARAPRELPEPTD--RHTAQ 123 P P +CA PR PEP RH AQ Sbjct: 96 PQPPLRCAACPRTFPEPAQLRRHLAQ 121
>SPESP_MACFA (Q95LJ2) Sperm equatorial segment protein 1 precursor| Length = 352 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 46 PHPHPRTQCARAPRELPEPTDRHTAQSTTTERTP 147 P P P + APR LP T+ T+ T+ ++P Sbjct: 147 PEPEPTARQTEAPRTLPVVTESSTSPYVTSYKSP 180
>PTP3_YEAST (P40048) Tyrosine-protein phosphatase 3 (EC 3.1.3.48)| (Protein-tyrosine phosphatase 3) (PTPase 3) Length = 928 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 59 HAPNAPAPLVSYQSRPTDTLRRAPPP 136 H+P A +PLVSY++ L+RA P Sbjct: 52 HSPKASSPLVSYKTSSPVLLKRATAP 77
>SPESP_HUMAN (Q6UW49) Sperm equatorial segment protein 1 precursor (SP-ESP)| (Equatorial segment protein) (ESP) (Glycosylated 38 kDa sperm protein C-7/8) Length = 350 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 46 PHPHPRTQCARAPRELPEPTDRHTAQSTTTERTP 147 P P P + APR LP T+ T+ T+ ++P Sbjct: 147 PEPEPAAKQTEAPRMLPVVTESSTSPYVTSYKSP 180
>CAC1E_MOUSE (Q61290) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2272 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 65 PNAPAPLVSYQSRPTDTLRRAPPPNGRHG 151 P P PL+SY S T +PPP+G G Sbjct: 2123 PPKPRPLLSYSSLMRHTGGISPPPDGSEG 2151
>WRK22_ARATH (O04609) WRKY transcription factor 22 (WRKY DNA-binding protein 22)| Length = 298 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 16 VTTQSSARSHPHPHPRTQCARAPRELPEPTDRHTAQSTTT 135 + T ++ +HP P R A + R+ +P+D+ T++S TT Sbjct: 176 IVTYTAEHNHPAPTHRNSLAGSTRQ--KPSDQQTSKSPTT 213
>CAC1E_RAT (Q07652) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (RBE-II) (RBE2) (Brain calcium channel II) (BII) Length = 2222 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 65 PNAPAPLVSYQSRPTDTLRRAPPPNGRHG 151 P P PL+SY S T +PPP+G G Sbjct: 2072 PPKPRPLLSYSSLMRHTGGISPPPDGSEG 2100
>AFLR_ASPPA (P43651) Aflatoxin biosynthesis regulatory protein| Length = 444 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 4 SVPVVTTQSSARSHPHPHP----RTQCARAPRELPEPTDRHTAQSTTTERTP 147 S P TQ+ +H HP P Q + P LP P + + + ++P Sbjct: 100 STPHAHTQAHTHAHSHPQPHPQSHPQSNQPPHALPTPNGSSSVSAIFSHQSP 151
>AFLR_ASPFL (P41765) Aflatoxin biosynthesis regulatory protein| Length = 437 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 4 SVPVVTTQSSARSHPHPHP----RTQCARAPRELPEPTDRHTAQSTTTERTP 147 S P TQ+ +H HP P Q + P LP P + + + ++P Sbjct: 100 STPHAHTQAHTHAHSHPQPHPQSHPQSNQPPHALPTPNGSSSVSAIFSHQSP 151
>GCS1_RAT (O88941) Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106)| (Glycoprotein-processing glucosidase I) Length = 834 Score = 27.7 bits (60), Expect = 8.1 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = -2 Query: 144 RPFGGGALRSVSVGRLW*LTRGAGALGAWVWVWVGSGRALSSH 16 R GGA +V V L G G WV W+G RAL+ H Sbjct: 36 RGSAGGAALAVVV-----LALAFGLSGRWVLAWLGVRRALTLH 73
>ZO1_MOUSE (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1745 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 16 VTTQSSARSHPHPHPRTQCARAPRELPEPTDRHTAQS 126 + + S RSH P PR +R+P + EP+D H+ QS Sbjct: 295 LASDHSGRSHDRP-PRRSQSRSPDQRSEPSD-HSTQS 329
>CSPG3_PANTR (Q5IS41) Neurocan core protein precursor (Chondroitin sulfate| proteoglycan 3) Length = 1321 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 1 ISVPVVTTQSSARSHPHPHPRTQ 69 + VP ++T S+ S PHP P Q Sbjct: 882 VGVPAMSTLGSSSSQPHPEPEDQ 904
>CSPG3_HUMAN (O14594) Neurocan core protein precursor (Chondroitin sulfate| proteoglycan 3) Length = 1321 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 1 ISVPVVTTQSSARSHPHPHPRTQ 69 + VP ++T S+ S PHP P Q Sbjct: 882 VGVPAMSTLGSSSSQPHPEPEDQ 904
>IF2_BIFLO (Q8G3Y5) Translation initiation factor IF-2| Length = 954 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 26 RARPDPTHTHTHAPNAPAPLVSYQSRPTDTLRRAPPPNGRHGE 154 +A P H P AP P RP R P GRHG+ Sbjct: 89 QASPASAHQQAPTPGAPTP------RPQGGARPGMPTPGRHGQ 125
>VGLD_PRVRI (P07645) Protein gp50| Length = 402 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 37 RSHPHPHPRTQCARAPRELPEPTDR-HTAQSTTTERTP 147 R P P P P LPEP R H A T R P Sbjct: 276 RPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPP 313 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.122 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,580,743 Number of Sequences: 219361 Number of extensions: 445793 Number of successful extensions: 1954 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1891 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)