| Clone Name | bast40h12 |
|---|---|
| Clone Library Name | barley_pub |
>BAR1_CHIPA (P08724) Balbiani ring protein 1 (Giant secretory protein I-A)| (GSP-IA) (Fragment) Length = 326 Score = 32.0 bits (71), Expect = 0.38 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 228 CTRSAGRFS-SLCRCVSASKSAMSQEDVLKIQTCV 329 C + GRFS S CRC SA K + S+ + TCV Sbjct: 51 CAKRKGRFSASKCRCTSAGKPSKSEPRTERPTTCV 85
>SH2P1_MOUSE (Q62018) SH2 domain-binding protein 1 (Tetratricopeptide| repeat-containing, SH2-binding phosphoprotein of 150 kDa) (TPR-containing, SH2-binding phosphoprotein of 150 kDa) (p150TSP) Length = 1173 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -2 Query: 275 RNAAAQRREAPRRSGAEETDAEGGSNQGQESRKKAATRK 159 +N + +PRRSG +E+D + S+Q R+++ + + Sbjct: 1061 QNKSGSEAGSPRRSGRQESDEDSDSDQPSRKRRRSGSEQ 1099
>VGLB_BHV1C (P12640) Glycoprotein I precursor (Glycoprotein GVP-6)| (Glycoprotein 11A) (Glycoprotein 16) (Glycoprotein G130) (Glycoprotein B) Length = 932 Score = 29.6 bits (65), Expect = 1.9 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = -2 Query: 332 EHAGLYLEHILLAHG*LAGRNAAAQRREAPRRSGAEETDAEGG 204 E A LYL+ + ++G L G AAA + PRR+ A GG Sbjct: 470 ELAKLYLQELARSNGTLEGLFAAAAPKPGPRRARRAAPSAPGG 512
>TOP2_CAEEL (Q23670) Probable DNA topoisomerase 2 (EC 5.99.1.3) (DNA| topoisomerase II) Length = 1520 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = -2 Query: 275 RNAAAQRREAPRRSGAEETDAEGGSNQGQESRKKAATRKHCSP 147 + A ++ AP++ +E +D GG + +E+ KK +T K SP Sbjct: 1397 KKPAPAKKAAPKKKKSEFSDLSGGDSD-EEAEKKPSTSKKPSP 1438
>VG22_ICHV1 (Q00105) Hypothetical gene 22 protein| Length = 1403 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 260 QRREAPRRSGAEETDAEGGSNQGQESRKKAATRKHCS 150 + R A R+ E A+GG Q + R + A HC+ Sbjct: 622 ENRMARRKMDPTEAAAKGGPRQSERPRSQTAVHAHCA 658
>ATRX_MOUSE (Q61687) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked nuclear protein) (Heterochromatin protein 2) (HP1 alpha-interacting protein) (HP1-BP38 protein) Length = 2476 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -2 Query: 275 RNAAAQRREAPRRSGAEETDAEGGSNQGQESRKKAATRK 159 RN++++R +S + +DAEG S ++ +K+ + K Sbjct: 1117 RNSSSKRNTKEVKSASSSSDAEGSSEDNKKQKKQRTSAK 1155
>BAR1_CHITE (P02849) Balbiani ring protein 1 (Giant secretory protein I-A)| (GSP-IA) (Fragment) Length = 174 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 228 CTRSAGRFS-SLCRCVSASKSAMSQE 302 C R GRF+ S CRC SA K + + E Sbjct: 17 CARRNGRFNASKCRCTSAGKPSRNSE 42 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 228 CTRSAGRFS-SLCRCVSASKSAMSQE 302 C R GRF+ S CRC SA K + E Sbjct: 99 CARRNGRFNASKCRCTSAGKPSRKSE 124 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,798,479 Number of Sequences: 219361 Number of extensions: 644872 Number of successful extensions: 1899 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1899 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)