ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast40g05 |
|---|---|
| Clone Library Name | barley_pub |
>FUSIP_MOUSE (Q9R0U0) FUS-interacting serine-arginine-rich protein 1| (TLS-associated protein with Ser-Arg repeats) (TLS-associated protein with SR repeats) (TASR) (TLS-associated serine-arginine protein) (TLS-associated SR protein) (Neural-specific SR pro Length = 262 Score = 68.2 bits (165), Expect = 1e-11 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 SL VRN+ R+EDLR F R+GP+ DVY+P D+Y+ PRGFA+V+F D DA +A Sbjct: 11 SLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDA 67
>FUSIP_HUMAN (O75494) FUS-interacting serine-arginine-rich protein 1| (TLS-associated protein with Ser-Arg repeats) (TLS-associated protein with SR repeats) (TASR) (TLS-associated serine-arginine protein) (TLS-associated SR protein) (40 kDa SR-repressor pr Length = 262 Score = 68.2 bits (165), Expect = 1e-11 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 SL VRN+ R+EDLR F R+GP+ DVY+P D+Y+ PRGFA+V+F D DA +A Sbjct: 11 SLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDA 67
>SRR35_HUMAN (Q8WXF0) 35 kDa SR repressor protein (SRrp35)| Length = 261 Score = 67.8 bits (164), Expect = 1e-11 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 SL +RN+ + R EDLR F R+GP+ DVY+P D+Y+ PRGFA+V+F D DA +A Sbjct: 11 SLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDA 67
>SFRS2_CHICK (P30352) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 221 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G SL V N+ + LR FE++G V DVY+P+D Y+ E RGFAFV F D DA + Sbjct: 11 EGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED 70 Query: 442 A 444 A Sbjct: 71 A 71
>SFRS2_RAT (Q6PDU1) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G SL V N+ + LR FE++G V DVY+P+D Y+ E RGFAFV F D DA + Sbjct: 10 EGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED 69 Query: 442 A 444 A Sbjct: 70 A 70
>SFRS2_PANTR (Q5R1W5) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G SL V N+ + LR FE++G V DVY+P+D Y+ E RGFAFV F D DA + Sbjct: 10 EGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED 69 Query: 442 A 444 A Sbjct: 70 A 70
>SFRS2_MOUSE (Q62093) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) (Putative myelin regulatory factor 1) (MRF-1) Length = 220 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G SL V N+ + LR FE++G V DVY+P+D Y+ E RGFAFV F D DA + Sbjct: 10 EGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED 69 Query: 442 A 444 A Sbjct: 70 A 70
>SFRS2_HUMAN (Q01130) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 220 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G SL V N+ + LR FE++G V DVY+P+D Y+ E RGFAFV F D DA + Sbjct: 10 EGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED 69 Query: 442 A 444 A Sbjct: 70 A 70
>RBM19_HUMAN (Q9Y4C8) Probable RNA-binding protein 19 (RNA-binding motif protein| 19) Length = 960 Score = 55.1 bits (131), Expect = 9e-08 Identities = 24/60 (40%), Positives = 40/60 (66%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 SG L VRN+P ++ EDL F ++GP+ +++ P D + +P+GFAF+ F+ P A +A+ Sbjct: 401 SGRLFVRNLPYTSTEEDLEKLFSKYGPLSELHYPIDSLTKKPKGFAFITFMFPEHAVKAY 460 Score = 50.4 bits (119), Expect = 2e-06 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYY-SGEPRGFAFVEFVDPYD 432 ++Q + +LVRNIP A + ++R F FG ++ V LPK +G RGF FV+F+ D Sbjct: 827 RKQTTSKILVRNIPFQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDFLTKQD 886 Query: 433 ASEA 444 A A Sbjct: 887 AKRA 890 Score = 36.2 bits (82), Expect = 0.043 Identities = 22/62 (35%), Positives = 33/62 (53%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 E+ +LV+N+P A +L+ F RFG + V LP E A VEF++P +A Sbjct: 583 ERSKTVILVKNLPAGTLAAELQETFGRFGSLGRVLLP------EGGTTAIVEFLEPLEAR 636 Query: 439 EA 444 +A Sbjct: 637 KA 638
>RSP4_CAEEL (Q09511) Probable splicing factor, arginine/serine-rich 4| (RNA-binding protein srp-2) (CeSC35) Length = 196 Score = 53.5 bits (127), Expect = 3e-07 Identities = 25/60 (41%), Positives = 35/60 (58%) Frame = +1 Query: 265 GSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G SL + N+ DLR FER+G + DV++P+D YS + +GF FV F + DA A Sbjct: 17 GLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHA 76
>RBM19_MOUSE (Q8R3C6) Probable RNA-binding protein 19 (RNA-binding motif protein| 19) Length = 952 Score = 52.0 bits (123), Expect = 8e-07 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYY-SGEPRGFAFVEFVDPYD 432 K+Q + +LVRNIP A ++R F FG ++ V LPK +G RGF FV+F+ D Sbjct: 819 KKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQD 878 Query: 433 ASEA 444 A +A Sbjct: 879 AKKA 882 Score = 51.2 bits (121), Expect = 1e-06 Identities = 24/60 (40%), Positives = 38/60 (63%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 SG L VRN+ ++ EDL F +GP+ +++ P D + +P+GFAFV F+ P A +A+ Sbjct: 399 SGRLFVRNLSYTSSEEDLEKLFSAYGPLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAY 458 Score = 34.7 bits (78), Expect = 0.12 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 E+ +L +N+P A +++ F RFG + V LP+ + A VEF++P +A Sbjct: 580 ERSKTVILAKNLPAGTLAAEIQETFSRFGSLGRVLLPEGGIT------AIVEFLEPLEAR 633 Query: 439 EA 444 +A Sbjct: 634 KA 635
>MRD1_YARLI (Q6CEW9) Multiple RNA-binding domain-containing protein 1| Length = 828 Score = 50.1 bits (118), Expect = 3e-06 Identities = 23/60 (38%), Positives = 40/60 (66%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 +G L +RN+ +A+ ED R F ++G + +V+LP + +G+ +GFA V+F DP +A A+ Sbjct: 300 TGRLFLRNLLYTAKEEDFRQLFSQYGELEEVHLPINTKTGQCKGFAHVQFEDPENAIAAY 359 Score = 45.4 bits (106), Expect = 7e-05 Identities = 23/63 (36%), Positives = 37/63 (58%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K+ +L++N+P A +D++ F FG ++ V +PK + S E RGFAF E+V +A Sbjct: 698 KKAIDSKILIKNLPFEATKKDVQKLFGAFGSLKTVRVPKKFNS-ESRGFAFAEYVSAKEA 756 Query: 436 SEA 444 A Sbjct: 757 EHA 759
>MRD1_ASHGO (Q75A83) Multiple RNA-binding domain-containing protein 1| Length = 838 Score = 48.9 bits (115), Expect = 6e-06 Identities = 25/63 (39%), Positives = 39/63 (61%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K++ SG ++V+N+P A +D+ F FG ++ V +PK + RGFAFVEF+ P +A Sbjct: 707 KKKISGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPKK-FDKSARGFAFVEFLLPSEA 765 Query: 436 SEA 444 A Sbjct: 766 ENA 768 Score = 48.9 bits (115), Expect = 6e-06 Identities = 24/65 (36%), Positives = 39/65 (60%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + +G L +RNI A ED + F +G + +V++ D +G+ +GFA+V F DP A Sbjct: 296 KIRATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHA 355 Query: 436 SEAHI 450 + A+I Sbjct: 356 ANAYI 360
>MRD1_CANGA (Q6FXP4) Multiple RNA-binding domain-containing protein 1| Length = 861 Score = 48.9 bits (115), Expect = 6e-06 Identities = 25/63 (39%), Positives = 38/63 (60%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K+ +G ++V+N+P A +D+ F FG ++ V +PK + RGFAFVEFV P +A Sbjct: 733 KKAKNGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKK-FDKSARGFAFVEFVLPKEA 791 Query: 436 SEA 444 A Sbjct: 792 ENA 794 Score = 47.8 bits (112), Expect = 1e-05 Identities = 23/65 (35%), Positives = 40/65 (61%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K Q +G L +RNI S+ +D + F +G +++V++ D +G +GFA+V F P +A Sbjct: 320 KIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEA 379 Query: 436 SEAHI 450 +A+I Sbjct: 380 VQAYI 384
>MRD1_KLULA (Q6CQR6) Multiple RNA-binding domain-containing protein 1| Length = 878 Score = 48.9 bits (115), Expect = 6e-06 Identities = 24/63 (38%), Positives = 38/63 (60%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K++ G ++V+N+P A +D+ F FG ++ V +PK + RGFAFVEF+ P +A Sbjct: 747 KKKNQGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPKK-FDKSARGFAFVEFLLPKEA 805 Query: 436 SEA 444 A Sbjct: 806 ENA 808 Score = 42.4 bits (98), Expect = 6e-04 Identities = 21/65 (32%), Positives = 39/65 (60%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + +G L +RNI +A +D R F +G + +V++ D +G+ +GFA+V F + +A Sbjct: 325 KIRETGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNA 384 Query: 436 SEAHI 450 + A + Sbjct: 385 ATAFV 389
>MRD1_CANAL (Q5AJS6) Multiple RNA-binding domain-containing protein 1| Length = 841 Score = 48.5 bits (114), Expect = 8e-06 Identities = 22/64 (34%), Positives = 39/64 (60%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + +G L +RNI A ED R F ++G + +V++ D +G+ +GF +V+F+ DA Sbjct: 305 KIEETGRLFIRNISYEASEEDFRSLFSQYGALEEVHIAIDTRTGKSKGFLYVQFLKKEDA 364 Query: 436 SEAH 447 + A+ Sbjct: 365 TRAY 368 Score = 41.6 bits (96), Expect = 0.001 Identities = 21/54 (38%), Positives = 31/54 (57%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 K S ++++N+P A +DL F FG ++ V +PK + RGFAFVEF Sbjct: 712 KSGKSSKIIIKNLPFEATRKDLLELFGAFGQLKSVRVPKK-FDQSARGFAFVEF 764
>IF34_SCHPO (P78795) Probable eukaryotic translation initiation factor 3| RNA-binding subunit (eIF-3 RNA-binding subunit) (eIF3 p33) (Translation initiation factor eIF3, p33 subunit) Length = 282 Score = 48.1 bits (113), Expect = 1e-05 Identities = 24/52 (46%), Positives = 32/52 (61%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 S +L V N+ R E+LR F RFG ++ VYL KD +G +GFAFV + D Sbjct: 201 SATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSYYD 252
>MRD1_ASPFU (Q4WJT7) Multiple RNA-binding domain-containing protein 1| Length = 825 Score = 48.1 bits (113), Expect = 1e-05 Identities = 21/60 (35%), Positives = 36/60 (60%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 S L VRN+P A DL F +FG + ++++ D S +GFA+V++++P A +A+ Sbjct: 300 SSRLFVRNLPYDASESDLEPVFSKFGKIEEIHVAFDTRSTTSKGFAYVQYIEPDAAVQAY 359 Score = 41.2 bits (95), Expect = 0.001 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 ++++N+P A +D+R F +G +R V +PK + RGF F +FV +A A Sbjct: 704 IIIKNLPFQATKKDVRSLFGAYGQLRSVRVPKK-FDRSARGFGFADFVSAREAENA 758 Score = 37.0 bits (84), Expect = 0.025 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRG-FAFVEFVDPYD 432 +E+G+ ++LV+N + +DLR FE +G + + +P P G A VEF P + Sbjct: 479 RERGNTAILVKNFSYGVKVDDLRKLFEPYGQITRLLMP-------PSGTIAIVEFARPDE 531 Query: 433 ASEA 444 A +A Sbjct: 532 AQKA 535
>MRD1_YEAST (Q06106) Multiple RNA-binding domain-containing protein 1| Length = 887 Score = 47.8 bits (112), Expect = 1e-05 Identities = 24/59 (40%), Positives = 36/59 (61%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 SG ++V+N+P A +D+ F FG ++ V +PK + RGFAFVEF+ P +A A Sbjct: 762 SGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKK-FDKSARGFAFVEFLLPKEAENA 819 Score = 46.6 bits (109), Expect = 3e-05 Identities = 22/61 (36%), Positives = 38/61 (62%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 +G L +RNI +++ ED R F FG + +V++ D +G+ +GFA+V F D +A A+ Sbjct: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403 Query: 448 I 450 + Sbjct: 404 V 404
>MRD1_SCHPO (O13620) Multiple RNA-binding domain-containing protein 1| Length = 833 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/58 (36%), Positives = 35/58 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAHI 450 L +RN+ S +DL+ F FG + V++P D + P+GFA+++F D DA A++ Sbjct: 325 LFLRNLTYSCAEDDLKSLFGPFGQLEQVHMPIDKKTNNPKGFAYIDFHDADDAVRAYL 382 Score = 40.8 bits (94), Expect = 0.002 Identities = 20/56 (35%), Positives = 33/56 (58%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L++N+P A +D++ +G +R V +PK + RGFAF EFV +A+ A Sbjct: 723 ILIKNLPFEATKKDVQSLLGAYGQLRSVRVPKK-FDRSARGFAFAEFVTAREAANA 777 Score = 30.0 bits (66), Expect = 3.1 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRG-FAFVEFVDPYDASEA 444 LLV+N P AE+L F FG + + +P P G A +EF++ D +A Sbjct: 508 LLVKNFPYGTSAEELTSLFSPFGELGRILIP-------PAGTIAIIEFLNAPDCRQA 557
>PABP2_MOUSE (Q8CCS6) Polyadenylate-binding protein 2 (Poly(A)-binding protein| 2) (PolyA binding protein II) (PABII) (Polyadenylate-binding nuclear protein 1) (Nuclear poly(A)-binding protein 1) Length = 301 Score = 43.9 bits (102), Expect = 2e-04 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E + S+ V N+ A AE+L F G V V + D +SG P+GFA++EF D Sbjct: 163 EADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD 217
>PABP2_HUMAN (Q86U42) Polyadenylate-binding protein 2 (Poly(A)-binding protein| 2) (PolyA binding protein II) (PABII) (Polyadenylate-binding nuclear protein 1) (Nuclear poly(A)-binding protein 1) Length = 305 Score = 43.9 bits (102), Expect = 2e-04 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E + S+ V N+ A AE+L F G V V + D +SG P+GFA++EF D Sbjct: 167 EADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD 221
>PABP2_BOVIN (Q28165) Polyadenylate-binding protein 2 (Poly(A)-binding protein| 2) (PolyA-binding protein II) (PABII) (Polyadenylate-binding nuclear protein 1) (Nuclear poly(A)-binding protein 1) Length = 305 Score = 43.9 bits (102), Expect = 2e-04 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E + S+ V N+ A AE+L F G V V + D +SG P+GFA++EF D Sbjct: 167 EADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD 221
>SFRS1_CHICK (Q5ZML3) Splicing factor, arginine/serine-rich 1| Length = 256 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V N+P R +D+ F ++G +RD+ L K+ G P FAFVEF DP DA +A Sbjct: 17 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDA 69
>SFRS1_PONPY (Q5R7H2) Splicing factor, arginine/serine-rich 1| Length = 247 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V N+P R +D+ F ++G +RD+ L K+ G P FAFVEF DP DA +A Sbjct: 17 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDA 69
>SFRS1_MOUSE (Q6PDM2) Splicing factor, arginine/serine-rich 1| Length = 247 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V N+P R +D+ F ++G +RD+ L K+ G P FAFVEF DP DA +A Sbjct: 17 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDA 69
>SFRS1_HUMAN (Q07955) Splicing factor, arginine/serine-rich 1 (pre-mRNA-splicing| factor SF2, P33 subunit) (Alternative splicing factor ASF-1) Length = 247 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V N+P R +D+ F ++G +RD+ L K+ G P FAFVEF DP DA +A Sbjct: 17 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDA 69
>IF34_MOUSE (Q9Z1D1) Eukaryotic translation initiation factor 3 subunit 4| (eIF-3 delta) (eIF3 p44) (eIF-3 RNA-binding subunit) (eIF3 p42) (Eif3p42) (eIF3g) Length = 320 Score = 43.1 bits (100), Expect = 3e-04 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + ++ V N+ R DL+ F FG + +YL KD +G+ +GFAF+ F DA+ A Sbjct: 238 NATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA 296
>IF34_HUMAN (O75821) Eukaryotic translation initiation factor 3 subunit 4| (eIF-3 delta) (eIF3 p44) (eIF-3 RNA-binding subunit) (eIF3 p42) (eIF3g) Length = 320 Score = 43.1 bits (100), Expect = 3e-04 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + ++ V N+ R DL+ F FG + +YL KD +G+ +GFAF+ F DA+ A Sbjct: 238 NATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA 296
>SFRS9_RAT (Q5PPI1) Splicing factor, arginine/serine-rich 9| Length = 221 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/61 (39%), Positives = 36/61 (59%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G G + V N+P R +DL F ++G +R++ L K+ + P FAFV F DP DA + Sbjct: 11 EGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIEL-KNRHGLVP--FAFVRFEDPRDAED 67 Query: 442 A 444 A Sbjct: 68 A 68
>SFRS9_HUMAN (Q13242) Splicing factor, arginine/serine-rich 9 (Pre-mRNA-splicing| factor SRp30C) Length = 221 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/61 (39%), Positives = 36/61 (59%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G G + V N+P R +DL F ++G +R++ L K+ + P FAFV F DP DA + Sbjct: 11 EGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIEL-KNRHGLVP--FAFVRFEDPRDAED 67 Query: 442 A 444 A Sbjct: 68 A 68
>SFRS1_XENTR (Q6DII2) Splicing factor, arginine/serine-rich 1| Length = 267 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V N+P R +D+ F ++G +RD+ L K+ G P FAFVEF DP DA +A Sbjct: 18 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDA 70
>SFRS9_MOUSE (Q9D0B0) Splicing factor, arginine/serine-rich 9| Length = 222 Score = 42.7 bits (99), Expect = 5e-04 Identities = 24/61 (39%), Positives = 36/61 (59%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 +G G + V N+P R +DL F ++G +R++ L K+ + P FAFV F DP DA + Sbjct: 12 EGDGRIYVGNLPSDVREKDLEDLFYKYGRIREIEL-KNRHGLVP--FAFVRFEDPRDAED 68 Query: 442 A 444 A Sbjct: 69 A 69
>SFRS1_BRARE (Q6NYA0) Splicing factor, arginine/serine-rich 1| Length = 245 Score = 42.7 bits (99), Expect = 5e-04 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V N+P R +D+ F ++G +RD+ L K+ G P FAFVEF DP DA +A Sbjct: 17 IYVGNLPPDIRTKDVEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDA 69
>SF1L1_BRARE (Q7SXP4) Splicing factor, arginine/serine-rich 1-like protein 1| Length = 245 Score = 42.7 bits (99), Expect = 5e-04 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V N+P R +D+ F ++G +RD+ L K+ G P FAFVEF DP DA +A Sbjct: 17 IYVGNLPPDIRTKDVEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDA 69
>RBM28_MOUSE (Q8CGC6) RNA-binding protein 28 (RNA-binding motif protein 28)| Length = 749 Score = 42.4 bits (98), Expect = 6e-04 Identities = 21/56 (37%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L++RN+ +DL+ F +G V +V +PK G+ RGFAFV+F + +A +A Sbjct: 115 LIIRNLSFKCSEDDLKAVFTHYGTVLEVNIPKK-PDGKMRGFAFVQFKNLLEAGKA 169 Score = 34.3 bits (77), Expect = 0.16 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +L V +P SAR++ L F + GPV+ ++ + S RGF +V F Sbjct: 4 TLFVGRLPPSARSDQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTF 51
>SFRS7_HUMAN (Q16629) Splicing factor, arginine/serine-rich 7 (Splicing factor| 9G8) Length = 238 Score = 42.4 bits (98), Expect = 6e-04 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = +1 Query: 265 GSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G + V N+ A +L F +GP+R V++ ++ P GFAFVEF DP DA +A Sbjct: 9 GETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN-----PPGFAFVEFEDPRDAEDA 63
>TRA2B_RAT (P62997) Arginine/serine-rich splicing factor 10| (Transformer-2-beta) (HTRA2-beta) (Transformer 2 protein homolog) (RA301) Length = 288 Score = 42.4 bits (98), Expect = 6e-04 Identities = 23/54 (42%), Positives = 29/54 (53%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V + L DLR F ++GP+ DV + D S RGFAFV F + DA EA Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA 175
>TRA2B_MOUSE (P62996) Arginine/serine-rich splicing factor 10| (Transformer-2-beta) (HTRA2-beta) (Transformer 2 protein homolog) (Silica-induced gene 41 protein) (SIG-41) Length = 288 Score = 42.4 bits (98), Expect = 6e-04 Identities = 23/54 (42%), Positives = 29/54 (53%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V + L DLR F ++GP+ DV + D S RGFAFV F + DA EA Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA 175
>TRA2B_HUMAN (P62995) Arginine/serine-rich splicing factor 10| (Transformer-2-beta) (HTRA2-beta) (Transformer 2 protein homolog) Length = 288 Score = 42.4 bits (98), Expect = 6e-04 Identities = 23/54 (42%), Positives = 29/54 (53%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V + L DLR F ++GP+ DV + D S RGFAFV F + DA EA Sbjct: 122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA 175
>MRD1_USTMA (Q4PC17) Multiple RNA-binding domain-containing protein 1| Length = 858 Score = 42.0 bits (97), Expect = 8e-04 Identities = 22/60 (36%), Positives = 32/60 (53%) Frame = +1 Query: 265 GSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 GS +L++N+P A D+R F G ++ V LPK + RGF FVE+ +A A Sbjct: 717 GSTKILIKNLPFEATKRDIRDLFSSQGQLKSVRLPKK-FDNTTRGFGFVEYSTVREAQSA 775
>RBM10_HUMAN (P98175) RNA-binding protein 10 (RNA-binding motif protein 10)| (DXS8237E) Length = 929 Score = 42.0 bits (97), Expect = 8e-04 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFG-PVRDVYLPKDYYSGEPRGFAFVEFVDPYD 432 +E+ S +++R +P +A +D+R + G R+V L ++ SG+ RGFAFVEF D Sbjct: 124 EEKASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQD 183 Query: 433 AS 438 A+ Sbjct: 184 AT 185
>RU17_DROME (P17133) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) Length = 448 Score = 41.6 bits (96), Expect = 0.001 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 +L + I LR FE +GP++ + L D SG+P+G+AF+E+ D A+ Sbjct: 103 TLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAY 160
>MRD1_EMENI (Q5BGA9) Multiple RNA-binding domain-containing protein 1| Length = 819 Score = 41.2 bits (95), Expect = 0.001 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 ++++N+P A +D+R F +G +R V +PK + RGF F +FV +A A Sbjct: 699 IIIKNLPFQATKKDVRSLFGAYGQLRSVRVPKK-FDRSARGFGFADFVSAREAENA 753 Score = 40.8 bits (94), Expect = 0.002 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 S L VRN+ + +L F FG + ++++ D +GFA+V++ DP A EA+ Sbjct: 294 SARLFVRNLSYETKESELEPVFSPFGKIEEIHVAFDTRFTTSKGFAYVQYADPDAAVEAY 353 Score = 36.2 bits (82), Expect = 0.043 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRG-FAFVEFVDPYD 432 +E+G+ ++LV+N + EDLR FE FG + + +P P G A V F P + Sbjct: 473 RERGNLAILVKNFSYGTKTEDLRKLFEPFGQITRLLMP-------PSGTIAIVAFARPDE 525 Query: 433 ASEA 444 A +A Sbjct: 526 AQKA 529
>RBM28_HUMAN (Q9NW13) RNA-binding protein 28 (RNA-binding motif protein 28)| Length = 758 Score = 41.2 bits (95), Expect = 0.001 Identities = 20/56 (35%), Positives = 34/56 (60%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L++RN+ +DL+ F +FG V +V +P+ G+ RGF FV+F + +A +A Sbjct: 115 LIIRNLSFKCSEDDLKTVFAQFGAVLEVNIPRK-PDGKMRGFGFVQFKNLLEAGKA 169 Score = 35.4 bits (80), Expect = 0.073 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +L V +P SAR+E L F + GPV+ ++ + S RGF +V F Sbjct: 4 TLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTF 51
>PPIL4_MOUSE (Q9CXG3) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-like protein PPIL4) Length = 492 Score = 40.8 bits (94), Expect = 0.002 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 EDL + F RFGP+R + +D+ +GE +AF+EF D +A Sbjct: 254 EDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKA 297
>PPIL4_HUMAN (Q8WUA2) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-like protein PPIL4) Length = 492 Score = 40.8 bits (94), Expect = 0.002 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 EDL + F RFGP+R + +D+ +GE +AF+EF D +A Sbjct: 254 EDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKA 297
>SFRS7_MOUSE (Q8BL97) Splicing factor, arginine/serine-rich 7| Length = 267 Score = 40.8 bits (94), Expect = 0.002 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V N+ A +L F +GP+R V++ ++ P GFAFVEF DP DA +A Sbjct: 44 VGNLGTGAGKGELERAFSYYGPLRTVWIARN-----PPGFAFVEFEDPRDAEDA 92
>RU17_XENTR (Q66II8) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 40.8 bits (94), Expect = 0.002 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 +L V + LR FE +GP++ +++ + SG+PRG+AF+E+ D A+ Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHMVYNKRSGKPRGYAFIEYEHERDMHSAY 161
>RBM3_MOUSE (O89086) Putative RNA-binding protein 3 (RNA-binding motif protein| 3) Length = 153 Score = 40.8 bits (94), Expect = 0.002 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G L V + + + L F FGP+ +V + KD + RGF F+ F +P AS+A Sbjct: 6 GKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDA 63
>IF34_CAEEL (Q19706) Probable eukaryotic translation initiation factor 3| subunit 4 (eIF-3 delta) (eIF3 p44) (eIF-3 RNA-binding subunit) (eIF3g) Length = 256 Score = 40.8 bits (94), Expect = 0.002 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V N+P ++LR F + G V +++ +D +G P+GFAFV F DA+ A Sbjct: 180 VTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARA 233
>RU17_HUMAN (P08621) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 437 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 +L V + LR FE +GP++ +++ SG+PRG+AF+E+ D A+ Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAY 161
>RU17_ARATH (Q42404) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 427 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/58 (27%), Positives = 33/58 (56%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 +L V + + ++ FE +GP++ V+L D + +P+G+AF+E++ D A+ Sbjct: 139 TLFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAAY 196
>HNRPG_HUMAN (P38159) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)| (RNA-binding motif protein, X chromosome) (Glycoprotein p43) Length = 391 Score = 40.4 bits (93), Expect = 0.002 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G L + + + L F ++G + +V L KD + + RGFAFV F P DA +A Sbjct: 8 GKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDA 65
>RU17_MOUSE (Q62376) U1 small nuclear ribonucleoprotein 70 kDa (U1 SNRNP 70| kDa) (snRNP70) Length = 448 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 +L V + LR FE +GP++ +++ SG+PRG+AF+E+ D A+ Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAY 161
>CSTF2_PONPY (Q5RDA3) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 577 Score = 40.4 bits (93), Expect = 0.002 Identities = 22/57 (38%), Positives = 29/57 (50%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S+ V NIP A E L+ F GPV L D +G+P+G+ F E+ D A A Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA 73
>CSTF2_HUMAN (P33240) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 577 Score = 40.4 bits (93), Expect = 0.002 Identities = 22/57 (38%), Positives = 29/57 (50%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S+ V NIP A E L+ F GPV L D +G+P+G+ F E+ D A A Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA 73
>PAB2_SCHPO (O14327) Polyadenylate-binding protein 2 (Poly(A)-binding protein| 2) (Poly(A)-binding protein II) (PABII) Length = 166 Score = 40.4 bits (93), Expect = 0.002 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDP 426 S+ V N+ S E+L+ F G V V + D ++G P+GFA++EF +P Sbjct: 56 SVYVGNVDYSVTPEELQSHFASCGSVNRVTILCDKFTGHPKGFAYIEFSEP 106
>CSTF2_MOUSE (Q8BIQ5) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 580 Score = 40.4 bits (93), Expect = 0.002 Identities = 22/57 (38%), Positives = 29/57 (50%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S+ V NIP A E L+ F GPV L D +G+P+G+ F E+ D A A Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA 73
>RBP1_DROME (Q02427) RNA-binding protein 1| Length = 144 Score = 40.4 bits (93), Expect = 0.002 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V N+ SA ++ F ++GP+R+V++ ++ P GFAFVEF D DA +A Sbjct: 15 VGNLGSSASKHEIEGAFAKYGPLRNVWVARN-----PPGFAFVEFEDRRDAEDA 63
>CSTF2_BOVIN (Q8HXM1) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 572 Score = 40.4 bits (93), Expect = 0.002 Identities = 22/57 (38%), Positives = 29/57 (50%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S+ V NIP A E L+ F GPV L D +G+P+G+ F E+ D A A Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA 73
>RSP6_CAEEL (Q18409) Probable splicing factor, arginine/serine-rich 6| (RNA-binding protein srp-1) (CeSRp20) Length = 179 Score = 40.0 bits (92), Expect = 0.003 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V +P A +++L F+RFG +R V++ + P GFAFVE+ D DA +A Sbjct: 7 VGGLPSDATSQELEEIFDRFGRIRKVWVAR-----RPPGFAFVEYDDVRDAEDA 55
>MRD1_CRYNE (Q5KJL5) Multiple RNA-binding domain-containing protein 1| Length = 769 Score = 40.0 bits (92), Expect = 0.003 Identities = 20/57 (35%), Positives = 31/57 (54%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 L VRN+ +E L F +G + + +LP +GEP G AF++F + DA A+ Sbjct: 223 LFVRNLAFITTSESLSSHFSTYGRIDECHLPVSQTTGEPLGTAFLQFHNAEDALAAY 279 Score = 38.9 bits (89), Expect = 0.007 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 5/64 (7%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYY-----SGEPRGFAFVEFVDPYD 432 S +LV+N+P A +D+R F +G ++ + LP+ + RGFAF+EF + Sbjct: 639 STKVLVKNLPFEATKKDVRELFSAYGQLKSLRLPRKAVPTSTGAQSTRGFAFLEFTTHTE 698 Query: 433 ASEA 444 A+ A Sbjct: 699 AARA 702
>RB27C_DROME (P48809) Heterogeneous nuclear ribonucleoprotein 27C (Hrb27-C)| (hnRNP 48) (HRP48.1) Length = 421 Score = 40.0 bits (92), Expect = 0.003 Identities = 22/57 (38%), Positives = 28/57 (49%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDP 426 +E G L V + E+L F RFG + D + K+ SG RGF FV F DP Sbjct: 2 EEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADP 58 Score = 37.7 bits (86), Expect = 0.015 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K+ G + + +P + DLR F R+G V +V + D + RGF F+ F + ++ Sbjct: 91 KKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE--ES 148 Query: 436 SEAHIT 453 S H+T Sbjct: 149 SVEHVT 154
>TIA1_HUMAN (P31483) Nucleolysin TIA-1 isoform p40 (RNA-binding protein TIA-1)| (p40-TIA-1) [Contains: Nucleolysin TIA-1 isoform p15 (p15-TIA-1)] Length = 386 Score = 39.7 bits (91), Expect = 0.004 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q + V ++ ED++ F FG + D + KD +G+ +G+ FV F + +DA Sbjct: 101 RSQNHFHVFVGDLSPQITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDA 160 Query: 436 SEA 444 A Sbjct: 161 ENA 163
>NOP4_YEAST (P37838) Nucleolar protein NOP4 (Nucleolar protein NOP77)| Length = 685 Score = 39.7 bits (91), Expect = 0.004 Identities = 22/56 (39%), Positives = 29/56 (51%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 S+ VRN+P A E L F +FG V+ D +G +G AFV F D Y +E Sbjct: 291 SVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQYTYNE 346 Score = 35.0 bits (79), Expect = 0.095 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L VR+IP E L F F P++ + KD + RGF FV F D EA Sbjct: 27 TLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKD-TNKRSRGFGFVSFAVEDDTKEA 82
>SFRS3_MOUSE (P84104) Splicing factor, arginine/serine-rich 3 (Pre-mRNA-splicing| factor SRP20) (X16 protein) Length = 164 Score = 39.7 bits (91), Expect = 0.004 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V N+ + +L F +GP+R V++ ++ P GFAFVEF DP DA++A Sbjct: 14 VGNLGNNGNKTELERAFGYYGPLRSVWVARN-----PPGFAFVEFEDPRDAADA 62
>SFRS3_HUMAN (P84103) Splicing factor, arginine/serine-rich 3 (Pre-mRNA-splicing| factor SRP20) Length = 164 Score = 39.7 bits (91), Expect = 0.004 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V N+ + +L F +GP+R V++ ++ P GFAFVEF DP DA++A Sbjct: 14 VGNLGNNGNKTELERAFGYYGPLRSVWVARN-----PPGFAFVEFEDPRDAADA 62
>RBM3_HUMAN (P98179) Putative RNA-binding protein 3 (RNA-binding motif protein| 3) (RNPL) Length = 157 Score = 39.3 bits (90), Expect = 0.005 Identities = 20/58 (34%), Positives = 29/58 (50%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G L V + + + L F FGP+ +V + KD + RGF F+ F +P AS A Sbjct: 6 GKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVA 63
>TIA1_MOUSE (P52912) Nucleolysin TIA-1 (RNA-binding protein TIA-1)| Length = 386 Score = 39.3 bits (90), Expect = 0.005 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q + V ++ ED++ F FG + D + KD +G+ +G+ FV F + +DA Sbjct: 101 RSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDA 160 Query: 436 SEA 444 A Sbjct: 161 ENA 163
>TADBP_HUMAN (Q13148) TAR DNA-binding protein 43 (TDP-43)| Length = 414 Score = 39.3 bits (90), Expect = 0.005 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 Q + L+V +P +DL+ F FG V V + KD +G +GF FV F + Sbjct: 101 QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTE 154 Score = 33.1 bits (74), Expect = 0.36 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 ++LR F ++G V DV++PK + R FAFV F D Sbjct: 205 DELREFFSQYGDVMDVFIPKPF-----RAFAFVTFAD 236
>DAZP1_MOUSE (Q9JII5) DAZ-associated protein 1 (Deleted in| azoospermia-associated protein 1) Length = 406 Score = 38.9 bits (89), Expect = 0.007 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S + V IP + +LR F++FG V +V + D PRGF F+ F D +A Sbjct: 112 SNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170
>TADBP_MOUSE (Q921F2) TAR DNA-binding protein 43 (TDP-43)| Length = 414 Score = 38.9 bits (89), Expect = 0.007 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 Q + L+V +P +DL+ F FG V V + KD +G +GF FV F + Sbjct: 101 QKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTE 154 Score = 32.0 bits (71), Expect = 0.81 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +1 Query: 310 AEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 AE+L+ F ++G V DV++PK + R FAFV F D Sbjct: 204 AEELQQFFCQYGEVVDVFIPKPF-----RAFAFVTFAD 236
>DAZP1_HUMAN (Q96EP5) DAZ-associated protein 1 (Deleted in| azoospermia-associated protein 1) Length = 407 Score = 38.9 bits (89), Expect = 0.007 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S + V IP + +LR F++FG V +V + D PRGF F+ F D +A Sbjct: 112 SNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170
>PPIE_DROME (Q9V3G3) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) Length = 300 Score = 38.5 bits (88), Expect = 0.009 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +1 Query: 331 FERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 F FG + D+ +P DY S RGFAF+E+ DA+ A Sbjct: 26 FIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAA 63
>DAZP1_XENLA (Q98SJ2) DAZ-associated protein 1 (Deleted in| azoospermia-associated protein 1) (Proline-rich Vg1 mRNA-binding protein) Length = 360 Score = 38.5 bits (88), Expect = 0.009 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S + V IP + +L+ F RFG V +V + D PRGF F+ F D +A Sbjct: 113 SNKIFVGGIPHNCGETELKEYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 171
>HNRPG_RAT (P84586) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)| (RNA-binding motif protein, X chromosome) Length = 388 Score = 38.5 bits (88), Expect = 0.009 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 G L + + + L F ++G + ++ L KD + + RGFAFV F P DA + Sbjct: 8 GKLFIGGLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKD 64
>TRA2A_MOUSE (Q6PFR5) Transformer-2 protein homolog (TRA-2 alpha)| Length = 281 Score = 38.5 bits (88), Expect = 0.009 Identities = 22/54 (40%), Positives = 28/54 (51%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V + L DLR F R+GP+ V + D +G RGFAFV F D+ EA Sbjct: 121 VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEA 174
>SXL_CHRRU (O97018) Sex-lethal homolog| Length = 307 Score = 38.5 bits (88), Expect = 0.009 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L+V +P +L F GP+ + KDY +G G+AFV+F DA A Sbjct: 86 NLIVNYLPQDMTDRELYALFRTCGPINTCRIMKDYKTGYSFGYAFVDFASEIDAQNA 142 Score = 37.4 bits (85), Expect = 0.019 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V N+P + ++L F ++G + + +D +G+PRG AFV F +A EA Sbjct: 172 NLYVTNLPRTITDDELEKIFGKYGNIVQKNILRDKLTGKPRGVAFVRFNKREEAQEA 228
>SXL_MUSDO (O17310) Sex-lethal homolog| Length = 324 Score = 38.5 bits (88), Expect = 0.009 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L+V +P +L F GP+ + KDY +G G+AFV+F DA A Sbjct: 103 NLIVNYLPQDMTDRELYALFRTCGPINTCRIMKDYKTGYSFGYAFVDFASEIDAQNA 159 Score = 37.0 bits (84), Expect = 0.025 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V N+P + ++L F ++G + + +D +G PRG AFV F +A EA Sbjct: 189 NLYVTNLPRTITDDELEKIFGKYGNIVQKNILRDKLTGRPRGVAFVRFNKREEAQEA 245
>RBY1A_HUMAN (Q15414) RNA-binding motif protein, Y chromosome, family 1 member| A1 (RNA-binding motif protein 1) Length = 496 Score = 38.5 bits (88), Expect = 0.009 Identities = 21/58 (36%), Positives = 31/58 (53%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G L + + + L+ F + GP+ +V L KD S + RGFAF+ F +P DA A Sbjct: 8 GKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTS-KSRGFAFITFENPADAKNA 64
>YNL0_YEAST (P53927) Hypothetical 25.4 kDa protein in CYB5-LEU4 intergenic| region Length = 220 Score = 38.5 bits (88), Expect = 0.009 Identities = 19/59 (32%), Positives = 34/59 (57%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 E+ SG + V +P ++L F +FG +++V L ++ +G R + F+EFV+ DA Sbjct: 87 EEYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDA 145
>PPIE_MOUSE (Q9QZH3) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) Length = 301 Score = 38.5 bits (88), Expect = 0.009 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = +1 Query: 319 LRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L F FG + D+ +P DY + + RGFAFVEF DA+ A Sbjct: 22 LHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAA 63
>PPIE_HUMAN (Q9UNP9) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) Length = 301 Score = 38.5 bits (88), Expect = 0.009 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = +1 Query: 319 LRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L F FG + D+ +P DY + + RGFAFVEF DA+ A Sbjct: 22 LHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAA 63
>TRA2A_HUMAN (Q13595) Transformer-2 protein homolog (TRA-2 alpha)| Length = 282 Score = 38.5 bits (88), Expect = 0.009 Identities = 22/54 (40%), Positives = 28/54 (51%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V + L DLR F R+GP+ V + D +G RGFAFV F D+ EA Sbjct: 123 VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEA 176
>HNRPR_HUMAN (O43390) Heterogeneous nuclear ribonucleoprotein R (hnRNP R)| Length = 633 Score = 38.5 bits (88), Expect = 0.009 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V IP ++L FE+ GP+ D+ L D SG+ RG+AF+ F A EA Sbjct: 167 VFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEA 222
>FOX1_CAEEL (Q10572) Sex determination protein fox-1 (Feminizing locus on X| protein 1) Length = 415 Score = 38.1 bits (87), Expect = 0.011 Identities = 24/60 (40%), Positives = 29/60 (48%) Frame = +1 Query: 265 GSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G L V NIP R DL+ FE+FG V DV + + +GF FV P DA A Sbjct: 151 GPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEI--IFNERGSKGFGFVTMERPQDAERA 208
>HNRPG_MOUSE (O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)| (RNA-binding motif protein, X chromosome) Length = 388 Score = 37.7 bits (86), Expect = 0.015 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G L + + + L F ++G + ++ L KD + + RGFAFV P DA +A Sbjct: 8 GKLFIGGLNTETNEKALEAVFGKYGRIVEIILMKDRETNKSRGFAFVTLESPADAKDA 65
>RBPA_SYNY3 (Q57014) Putative RNA-binding protein rbpA| Length = 101 Score = 37.7 bits (86), Expect = 0.015 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVE 414 S+ V N+ DL F +G V+ V LP D +G RGF FVE Sbjct: 2 SIYVGNLSYDVSEADLTAVFAEYGSVKRVQLPTDRETGRMRGFGFVE 48
>NUCL_CHICK (P15771) Nucleolin (Protein C23)| Length = 694 Score = 37.7 bits (86), Expect = 0.015 Identities = 23/62 (37%), Positives = 35/62 (56%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 E+ S +L+V N+ +A E L+ E F + +P++ G P+G+AFVEF DA Sbjct: 457 ERESKTLIVNNLSYAASEETLQ---ELFKKATSIKMPQNN-QGRPKGYAFVEFPTAEDAK 512 Query: 439 EA 444 EA Sbjct: 513 EA 514 Score = 32.7 bits (73), Expect = 0.47 Identities = 23/61 (37%), Positives = 28/61 (45%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 Q S +L VR + E LR FE R V D +G +GF FV+F P DA Sbjct: 550 QQSKTLFVRGLSEDTTEETLRESFEGSISARIV---TDRDTGSSKGFGFVDFSSPEDAKA 606 Query: 442 A 444 A Sbjct: 607 A 607
>PM14_MOUSE (P59708) Pre-mRNA branch site protein p14 (SF3B 14 kDa subunit)| Length = 125 Score = 37.7 bits (86), Expect = 0.015 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L +RN+P AE++ F ++GP+R + + + E RG A+V + D +DA A Sbjct: 21 LYIRNLPYKITAEEMYDIFGKYGPIRQIRVGN---TPETRGTAYVVYEDIFDAKNA 73
>PM14_HUMAN (Q9Y3B4) Pre-mRNA branch site protein p14 (SF3B 14 kDa subunit)| Length = 125 Score = 37.7 bits (86), Expect = 0.015 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L +RN+P AE++ F ++GP+R + + + E RG A+V + D +DA A Sbjct: 21 LYIRNLPYKITAEEMYDIFGKYGPIRQIRVGN---TPETRGTAYVVYEDIFDAKNA 73
>GAR2_SCHPO (P41891) Protein gar2| Length = 500 Score = 37.7 bits (86), Expect = 0.015 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 S ++ V N+ +A +DL F G ++ + LP D SG +GF +V F D Sbjct: 365 SDTVFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSD 416
>CSTFT_HUMAN (Q9H0L4) Cleavage stimulation factor, 64 kDa subunit, tau variant| (CSTF 64 kDa subunit, tau variant) (CF-1 64 kDa subunit, tau variant) (TauCstF-64) Length = 616 Score = 37.4 bits (85), Expect = 0.019 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S+ V NIP A E L+ F G V L D +G+P+G+ F E+ D A A Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSA 73
>CSTFT_MOUSE (Q8C7E9) Cleavage stimulation factor, 64 kDa subunit, tau variant| (CSTF 64 kDa subunit, tau variant) (CF-1 64 kDa subunit, tau variant) (TauCstF-64) Length = 632 Score = 37.4 bits (85), Expect = 0.019 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S+ V NIP A E L+ F G V L D +G+P+G+ F E+ D A A Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSA 73
>PPIL4_ASPFU (Q4WAQ9) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 459 Score = 37.4 bits (85), Expect = 0.019 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 EDL++ F RFGP+ + +D +G+ +AF+EF + D +A+ Sbjct: 262 EDLQLIFSRFGPILSCEVIRDKRTGDSLQYAFIEFENQKDCEQAY 306
>NUCL_XENLA (P20397) Nucleolin (Protein C23)| Length = 650 Score = 37.0 bits (84), Expect = 0.025 Identities = 23/62 (37%), Positives = 34/62 (54%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 E S L+V N+ SA + LR FE+ +R +P++ G +GFAF+EF DA Sbjct: 410 EGDSKVLVVNNLSYSATEDSLREVFEKATSIR---IPQN--QGRAKGFAFIEFSSAEDAK 464 Query: 439 EA 444 +A Sbjct: 465 DA 466
>RB97D_DROME (Q02926) Ribonucleoprotein RB97D| Length = 471 Score = 37.0 bits (84), Expect = 0.025 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAHI 450 E LR F +FG V V L D +G+ RGFAFVEF D YDA + I Sbjct: 137 ECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEF-DDYDAVDKAI 181
>SF3B4_HUMAN (Q15427) Splicing factor 3B subunit 4 (Spliceosome-associated| protein 49) (SAP 49) (SF3b50) (Pre-mRNA-splicing factor SF3b 49 kDa subunit) Length = 424 Score = 37.0 bits (84), Expect = 0.025 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 331 FERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 F + GPV + ++PKD +G+ +G+ FVEF+ DA A Sbjct: 33 FLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA 70
>SXL_DROSU (Q24668) Protein sex-lethal| Length = 354 Score = 37.0 bits (84), Expect = 0.025 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L+V +P +L F GP+ + +DY +G G+AFV+F D+ A Sbjct: 128 NLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA 184 Score = 35.4 bits (80), Expect = 0.073 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V N+P + + L F ++G + + +D +G PRG AFV + +A EA Sbjct: 214 NLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEA 270
>SXL_DROME (P19339) Protein sex-lethal| Length = 354 Score = 37.0 bits (84), Expect = 0.025 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L+V +P +L F GP+ + +DY +G G+AFV+F D+ A Sbjct: 126 NLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA 182 Score = 35.4 bits (80), Expect = 0.073 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V N+P + + L F ++G + + +D +G PRG AFV + +A EA Sbjct: 212 NLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEA 268
>SXL_MEGSC (O01671) Sex-lethal homolog| Length = 321 Score = 37.0 bits (84), Expect = 0.025 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V N+ S E L F ++G + + +D ++G PRG AF+ F +A EA Sbjct: 165 NLYVTNLSRSITDEQLETIFGKYGQIVQKNILRDKHTGTPRGVAFIRFNKREEAQEA 221 Score = 34.7 bits (78), Expect = 0.12 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L+V +P + +L F GP+ + +DY +G G+ FV+F DA A Sbjct: 79 NLIVNYLPQDMQDRELYSLFRTIGPINTCRIMRDYKTGYSYGYGFVDFGSEADALRA 135
>SFRS5_MOUSE (O35326) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Delayed-early protein HRS) Length = 270 Score = 36.6 bits (83), Expect = 0.033 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +1 Query: 301 SARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +AR +D+ F+ +G +RD+ L RGF FVEF DP DA +A Sbjct: 14 AAREKDVERFFKGYGRIRDIDLK--------RGFGFVEFEDPRDADDA 53
>ROAA_HUMAN (Q99729) Heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B)| (APOBEC-1-binding protein 1) (ABBP-1) Length = 331 Score = 36.6 bits (83), Expect = 0.033 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E+ +G + V + +DL+ F +FG V D + D +G RGF F+ F D Sbjct: 64 EEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKD 118 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +1 Query: 295 PLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 P S E +R F FG + + LP D + RGF F+ F Sbjct: 161 PESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITF 201
>MSI2H_MOUSE (Q920Q6) RNA-binding protein Musashi homolog 2 (Musashi-2)| Length = 346 Score = 36.6 bits (83), Expect = 0.033 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDP 426 G + + + + LR F +FG +R+ + +D + RGF FV F DP Sbjct: 21 GKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADP 72 Score = 33.5 bits (75), Expect = 0.28 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 + V + + ED++ FE+FG V D L D + RGF FV F Sbjct: 112 IFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTF 158
>PUF68_DROME (Q8T6B9) Poly U-binding splicing factor half pint (68 kDa poly| U-binding splicing factor) (Protein half pint) (PUF60 homolog) Length = 637 Score = 36.6 bits (83), Expect = 0.033 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V +I + + +RV F FGP++ + + D + + +GFAFVE+ P A A Sbjct: 134 VGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLA 187
>SXL_CERCA (O61374) Sex-lethal homolog (CCSXL)| Length = 348 Score = 36.6 bits (83), Expect = 0.033 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V N+P + + L F ++G + + +D +G+PRG AFV F +A EA Sbjct: 197 NLYVTNLPRTITDDQLDTIFGKYGMIVQKNILRDKLTGKPRGVAFVRFNKREEAQEA 253 Score = 35.8 bits (81), Expect = 0.056 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L+V +P +L F GP+ + +DY +G G+AFV+F D+ A Sbjct: 111 NLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFAAETDSQRA 167
>SFRS5_HUMAN (Q13243) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Delayed-early protein HRS) Length = 272 Score = 36.6 bits (83), Expect = 0.033 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +1 Query: 301 SARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +AR +D+ F+ +G +RD+ L RGF FVEF DP DA +A Sbjct: 14 AAREKDVERFFKGYGRIRDIDLK--------RGFGFVEFEDPRDADDA 53
>MSI2H_HUMAN (Q96DH6) RNA-binding protein Musashi homolog 2 (Musashi-2)| Length = 328 Score = 36.6 bits (83), Expect = 0.033 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDP 426 G + + + + LR F +FG +R+ + +D + RGF FV F DP Sbjct: 21 GKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADP 72 Score = 33.5 bits (75), Expect = 0.28 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 + V + + ED++ FE+FG V D L D + RGF FV F Sbjct: 112 IFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTF 158
>ROAA_MOUSE (Q99020) Heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B)| (CArG-binding factor-A) (CBF-A) Length = 285 Score = 36.6 bits (83), Expect = 0.033 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E+ +G + V + +DL+ F +FG V D + D +G RGF F+ F D Sbjct: 71 EEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKD 125 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 + V + A E +R F +FG + + LP D + RGF F+ F Sbjct: 161 IFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITF 207
>SFRS5_RAT (Q09167) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Insulin-induced growth response protein CL-4) (Delayed-early protein HRS) Length = 269 Score = 36.6 bits (83), Expect = 0.033 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +1 Query: 301 SARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +AR +D+ F+ +G +RD+ L RGF FVEF DP DA +A Sbjct: 14 AAREKDVERFFKGYGRIRDIDLK--------RGFGFVEFEDPRDADDA 53
>DRBP1_MOUSE (Q8BHN5) Developmentally-regulated RNA-binding protein 1 (RB-1)| Length = 476 Score = 36.2 bits (82), Expect = 0.043 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +1 Query: 292 IPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 IP S EDLR F+ +G + + K+ +GE +G +V ++ P A++A Sbjct: 127 IPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQA 177
>DRBP1_HUMAN (Q8IUH3) Developmentally-regulated RNA-binding protein 1 (RB-1)| Length = 476 Score = 36.2 bits (82), Expect = 0.043 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +1 Query: 292 IPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 IP S EDLR F+ +G + + K+ +GE +G +V ++ P A++A Sbjct: 127 IPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQA 177
>SFRS1_ARATH (O22315) Pre-mRNA-splicing factor SF2 (SR1 protein)| Length = 303 Score = 36.2 bits (82), Expect = 0.043 Identities = 21/61 (34%), Positives = 32/61 (52%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 + S ++ V N+P R ++ F ++GPV + L P G+AFVEF D DA + Sbjct: 4 RSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLK---VPPRPPGYAFVEFDDARDAED 60 Query: 442 A 444 A Sbjct: 61 A 61
>RNPC2_MOUSE (Q8VH51) RNA-binding region-containing protein 2 (Coactivator of| activating protein 1 and estrogen receptors) (Coactivator of AP-1 and ERs) (Transcription coactivator CAPER) Length = 530 Score = 36.2 bits (82), Expect = 0.043 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 +E+ + ++ + R DL F G VRDV + D S RG A+VEFVD Sbjct: 148 EERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSRGIAYVEFVD 203
>MRD1_NEUCR (Q7SG09) Multiple RNA-binding domain-containing protein 1| Length = 827 Score = 36.2 bits (82), Expect = 0.043 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAHIT 453 L +RN+ + +D+R F +FG + +V++P D G +GFA + + P A A T Sbjct: 310 LFLRNLSYTVTEDDVREHFAKFGILVEVHVPLD-SKGHSKGFAMIRYEKPASALAAFQT 367 Score = 35.4 bits (80), Expect = 0.073 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L+V+N+P +++R F +G + + +PK ++ RGFAF EF +A A Sbjct: 706 LVVKNLPFEVTKKEVRTLFSAYGKLVALRIPKK-FNQSSRGFAFAEFSTAKEALNA 760
>ROA1_DROME (P07909) Heterogeneous nuclear ribonucleoprotein A1 (hnRNP core| protein A1-A) (PEN repeat clone P9) Length = 365 Score = 36.2 bits (82), Expect = 0.043 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYD 432 + +R F+ FG + D+ + D +G+ RGFAFVEF D YD Sbjct: 136 QSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEF-DDYD 174 Score = 31.2 bits (69), Expect = 1.4 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 L + + E+L+ FE++G + DV + KD + RGF F+ + Sbjct: 33 LFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITY 79
>DRBP1_RAT (Q8CFD1) Developmentally-regulated RNA-binding protein 1| Length = 476 Score = 35.8 bits (81), Expect = 0.056 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +1 Query: 292 IPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 IP S EDLR F+ +G + + K+ +GE +G +V ++ P A++A Sbjct: 127 IPKSYTEEDLREKFKVYGDIEYCSVIKNKVTGESKGLGYVRYLKPSQAAQA 177
>RSD1_SCHPO (O13845) RNA-binding protein rsd1| Length = 604 Score = 35.8 bits (81), Expect = 0.056 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +E+ ++ V + + +L FE+ GPVRD + +D SG +G A+VEF Sbjct: 235 EERDRRTVFVSQLANRLTSRELYDFFEQAGPVRDAQIVRDKISGRSKGVAYVEF 288
>ROA3_HUMAN (P51991) Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3)| Length = 378 Score = 35.8 bits (81), Expect = 0.056 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I +LR FE++G + + + +D SG+ RGFAFV F D Sbjct: 128 IFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + + LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 37 LFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAA 92
>CHA1_BOMMO (P08826) Chorion class A protein L11 precursor| Length = 129 Score = 35.8 bits (81), Expect = 0.056 Identities = 24/59 (40%), Positives = 27/59 (45%) Frame = -2 Query: 196 LGGCGAGGCHHIPSLGDYDVQGYRHNPSSGDYGVGGCTSSWYCCAWSGERPGRSAAAGV 20 LGGCG GG LG Y + GY G YG GG +Y + GE G AGV Sbjct: 28 LGGCGCGG-----GLGGYGL-GYGLGGYGGGYGYGGYGGGYY-GGYGGEGVGNVGVAGV 79
>HNRPQ_RAT (Q7TP47) Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)| (hnRNP-Q) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) (Liver regeneration-related protein LRRG077) Length = 533 Score = 35.8 bits (81), Expect = 0.056 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V IP ++L FE+ GP+ D+ L D +G RG+AFV F A EA Sbjct: 74 IFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEA 129
>RBM5_HUMAN (P52756) RNA-binding protein 5 (RNA-binding motif protein 5)| (Putative tumor suppressor LUCA15) (G15 protein) (NY-REN-9 antigen) Length = 815 Score = 35.8 bits (81), Expect = 0.056 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERF-GPV-RDVYLPKDYYSGEPRGFAFVEFVDPYD 432 E+ S ++++R +P++ D+R E F GP DV L K +G RGFAFVEF D Sbjct: 94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRK-TGVSRGFAFVEFYHLQD 152 Query: 433 AS 438 A+ Sbjct: 153 AT 154
>ROA3_RAT (Q6URK4) Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3)| Length = 379 Score = 35.8 bits (81), Expect = 0.056 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I +LR FE++G + + + +D SG+ RGFAFV F D Sbjct: 128 IFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + + LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 37 LFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAA 92
>ROA3_MOUSE (Q8BG05) Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3)| Length = 379 Score = 35.8 bits (81), Expect = 0.056 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I +LR FE++G + + + +D SG+ RGFAFV F D Sbjct: 128 IFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + + LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 37 LFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAA 92
>HNRPQ_MOUSE (Q7TMK9) Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)| (hnRNP-Q) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) (Glycine-and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (pp68) Length = 623 Score = 35.8 bits (81), Expect = 0.056 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V IP ++L FE+ GP+ D+ L D +G RG+AFV F A EA Sbjct: 164 IFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEA 219
>HNRPQ_HUMAN (O60506) Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)| (hnRNP-Q) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) (Glycine-and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) Length = 623 Score = 35.8 bits (81), Expect = 0.056 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + V IP ++L FE+ GP+ D+ L D +G RG+AFV F A EA Sbjct: 164 IFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEA 219
>PM14_CAEEL (Q8ITY4) Pre-mRNA branch site p14-like protein| Length = 138 Score = 35.4 bits (80), Expect = 0.073 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L ++N+P E++ F +FG VR + + + E RG AFV + D +DA A Sbjct: 21 LYIKNLPYKITTEEMYEIFGKFGAVRQIRVGN---TAETRGTAFVVYEDIFDAKTA 73
>RU17_XENLA (P09406) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 35.4 bits (80), Expect = 0.073 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRD---VYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V + LR FE +GP++ VY SG+PRG+AF+E+ D A Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHIVYNKGSEGSGKPRGYAFIEYEHERDMHSA 163 Query: 445 H 447 + Sbjct: 164 Y 164
>PM14_ARATH (Q9FMP4) Pre-mRNA branch site p14-like protein| Length = 124 Score = 35.4 bits (80), Expect = 0.073 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L VRN+P + +E++ F ++G +R + + D + +G AFV + D YDA A Sbjct: 21 LYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKAT---KGTAFVVYEDIYDAKNA 73
>PPIL4_USTMA (P0C196) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 551 Score = 35.4 bits (80), Expect = 0.073 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 307 RAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 R++DL + F RFG + + KD +G+ +AF+EF DA A+ Sbjct: 274 RSDDLELIFSRFGKILSCEVIKDKKTGDSLQYAFIEFDKKDDAERAY 320
>GRP8_ARATH (Q03251) Glycine-rich RNA-binding protein 8 (CCR1 protein)| Length = 169 Score = 35.0 bits (79), Expect = 0.095 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 EDL+ F +FG V D + D SG RGF FV F D Sbjct: 20 EDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56
>RO21_XENLA (P51989) Heterogeneous nuclear ribonucleoprotein A2 homolog 1| (hnRNP A2(A)) Length = 346 Score = 35.0 bits (79), Expect = 0.095 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 L V I LR FE +G + + + D SG+ RGFAFV F D Sbjct: 102 LFVGGIKEDTEEHHLREYFEEYGKIDSIEIITDKQSGKKRGFAFVTFDD 150
>TXA12_ANTEL (P0C1F1) Toxin APE 1-2| Length = 47 Score = 35.0 bits (79), Expect = 0.095 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -2 Query: 163 IPSLGDYDVQGYRHNPSSGDYGVGGCTSSWYCCAWSG 53 +P L D D R N SG Y + GC S W+ C SG Sbjct: 2 VPCLCDSDGPNVRGNTLSGTYWLAGCPSGWHNCKSSG 38
>RB87F_DROME (P48810) Heterogeneous nuclear ribonucleoprotein 87F (HRP36.1| protein) (Protein P11) Length = 385 Score = 35.0 bits (79), Expect = 0.095 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYD 432 E LR F+ FG + V + D +G+ RGFAF+EF D YD Sbjct: 129 ECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEF-DDYD 167 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPY 429 L + + + L+ FE++G + DV + KD + RGF F+ + Y Sbjct: 26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSY 76
>PPIL4_NEUCR (Q871A4) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 494 Score = 35.0 bits (79), Expect = 0.095 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 EDL + F RFG + + +D +G+ +AF+EF D EA+ Sbjct: 267 EDLELIFSRFGKILSCEVIRDQKTGDSLQYAFIEFEDKKSCEEAY 311
>RNPC2_HUMAN (Q14498) RNA-binding region-containing protein 2 (Hepatocellular| carcinoma protein 1) (Splicing factor HCC1) Length = 530 Score = 35.0 bits (79), Expect = 0.095 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 +E+ + ++ + R DL F G VRDV + D S +G A+VEFVD Sbjct: 148 EERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVD 203
>NUCL_MOUSE (P09405) Nucleolin (Protein C23)| Length = 706 Score = 35.0 bits (79), Expect = 0.095 Identities = 21/59 (35%), Positives = 36/59 (61%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S +L++ N+ SA E L FE+ ++ +P++ + G+P+G+AF+EF DA EA Sbjct: 485 SKTLVLSNLSYSATKETLEEVFEKATFIK---VPQNPH-GKPKGYAFIEFASFEDAKEA 539 Score = 29.6 bits (65), Expect = 4.0 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q S +L V+ + E L+ FE G VR + D +G +GF FV+F DA Sbjct: 563 RSQPSKTLFVKGLSEDTTEETLKESFE--GSVR-ARIVTDRETGSSKGFGFVDFNSEEDA 619 Query: 436 SEA 444 A Sbjct: 620 KAA 622
>RRP2_SPIOL (P82277) Plastid-specific 30S ribosomal protein 2, chloroplast| precursor (PSRP-2) Length = 260 Score = 35.0 bits (79), Expect = 0.095 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 +G+ L V NIP + ++LR E G + + D YSG R F FV DA+ Sbjct: 81 EGARRLYVGNIPRNLNNDELRTIVEEHGAIEIAEVMYDKYSGRSRRFGFVTMKTVEDAN 139
>ROA1_XENLA (P17130) Heterogeneous nuclear ribonucleoproteins A1 homolog (hnRNP| A1) (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) Length = 365 Score = 35.0 bits (79), Expect = 0.095 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I + LR FE++G + + + D SG+ RGFAFV F D Sbjct: 107 IFVGGIKEDTEEDHLREYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFED 155 Score = 31.6 bits (70), Expect = 1.1 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFV--DPYDAS 438 L + + E LR FE++G + D + +D S RGF FV ++ D DA+ Sbjct: 16 LFIGGLSFETTDESLREHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYLSTDEVDAA 71
>PM14_DROME (Q9VRV7) Pre-mRNA branch site p14-like protein| Length = 121 Score = 35.0 bits (79), Expect = 0.095 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L VRN+P ++++ F +FG +R + + + E RG AFV + D +DA A Sbjct: 17 LYVRNLPYKITSDEMYDIFGKFGAIRQIRVGN---TPETRGTAFVVYEDIFDAKNA 69
>SGN1_YEAST (P40561) RNA-binding protein SGN1| Length = 250 Score = 34.7 bits (78), Expect = 0.12 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDP 426 E S S+ V NI E + F+ G ++ + L D +G P+G+ ++EF P Sbjct: 60 EADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESP 115
>SQD_DROME (Q08473) RNA-binding protein squid (Heterogeneous nuclear| ribonucleoprotein 40) (HNRNP 40) Length = 344 Score = 34.7 bits (78), Expect = 0.12 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF-----VDPYDASE 441 L V + ++LR F ++G + + + D +G RGFAF+ F +D A++ Sbjct: 58 LFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAAD 117 Query: 442 AHI 450 HI Sbjct: 118 EHI 120 Score = 31.6 bits (70), Expect = 1.1 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 G + V + E+++ F +FG + +V +P D + +GF F+ F Sbjct: 136 GKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184
>ROC5_NICSY (P19684) 33 kDa ribonucleoprotein, chloroplast precursor| Length = 324 Score = 34.7 bits (78), Expect = 0.12 Identities = 21/58 (36%), Positives = 27/58 (46%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G L V N+P S + L F G V +V + D + RGFAFV +A EA Sbjct: 114 GRLYVGNLPFSMTSSQLSEIFAEAGTVANVEIVYDRVTDRSRGFAFVTMGSVEEAKEA 171
>SRP1_SCHPO (Q10193) Pre-mRNA-splicing factor srp1| Length = 275 Score = 34.3 bits (77), Expect = 0.16 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +1 Query: 307 RAEDLRVPFERFGPVR--DVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 RA +L FE FGP+ D+ +P+ S R FAFVE+ D DA +A+ Sbjct: 19 RARELAYEFEPFGPLIRCDIPIPRTRTS---RPFAFVEYEDSRDAEDAY 64
>RBM4_BRARE (Q6IQ97) RNA-binding protein 4 (RNA-binding motif protein 4)| Length = 419 Score = 34.3 bits (77), Expect = 0.16 Identities = 24/63 (38%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI S ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KPKTSTKLHVGNISSSCTNQELRAKFEEYGPVVECDIVKDY--------AFVHMERVEDA 124 Query: 436 SEA 444 EA Sbjct: 125 MEA 127
>A2BP1_MOUSE (Q9JJ43) Ataxin-2-binding protein 1| Length = 396 Score = 34.3 bits (77), Expect = 0.16 Identities = 22/56 (39%), Positives = 28/56 (50%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L V NIP R DLR F +FG + DV + + +GF FV F + DA A Sbjct: 118 LHVSNIPFRFRDPDLRQMFGQFGKILDVEI--IFNERGSKGFGFVTFENSADADRA 171
>A2BP1_HUMAN (Q9NWB1) Ataxin-2-binding protein 1| Length = 397 Score = 34.3 bits (77), Expect = 0.16 Identities = 22/56 (39%), Positives = 28/56 (50%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L V NIP R DLR F +FG + DV + + +GF FV F + DA A Sbjct: 119 LHVSNIPFRFRDPDLRQMFGQFGKILDVEI--IFNERGSKGFGFVTFENSADADRA 172
>MSI1H_HUMAN (O43347) RNA-binding protein Musashi homolog 1 (Musashi-1)| Length = 362 Score = 34.3 bits (77), Expect = 0.16 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 + V + ++ ED++ FE+FG V D L D + RGF FV F Sbjct: 111 IFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 157 Score = 31.6 bits (70), Expect = 1.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E LR F +FG V++ + +D + RGF FV F+D Sbjct: 34 EGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD 70
>RSP3_CAEEL (Q9NEW6) Probable splicing factor, arginine/serine-rich 3 (CeSF2)| (CeSF2/ASF) Length = 258 Score = 34.3 bits (77), Expect = 0.16 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +1 Query: 283 VRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 V N+P R +++ F ++G ++ V D SG FAFVEF D DA +A Sbjct: 13 VGNLPGDVREKEVEDIFHKYGRIKYV----DIKSGRGPAFAFVEFEDHRDAEDA 62
>RBM9_HUMAN (O43251) RNA-binding protein 9 (RNA-binding motif protein 9)| (Hexaribonucleotide-binding protein 2) (Repressor of tamoxifen transcriptional activity) Length = 390 Score = 34.3 bits (77), Expect = 0.16 Identities = 22/56 (39%), Positives = 28/56 (50%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L V NIP R DLR F +FG + DV + + +GF FV F + DA A Sbjct: 123 LHVSNIPFRFRDPDLRQMFGQFGKILDVEI--IFNERGSKGFGFVTFENSADADRA 176
>RBM4_RABIT (Q9BDY9) RNA-binding protein 4 (RNA-binding motif protein 4) (Lark| homolog) Length = 359 Score = 33.9 bits (76), Expect = 0.21 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI + ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDY--------AFVHMERAEDA 124 Query: 436 SEA 444 EA Sbjct: 125 VEA 127
>RBM4B_HUMAN (Q9BQ04) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 359 Score = 33.9 bits (76), Expect = 0.21 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI + ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDY--------AFVHMERAEDA 124 Query: 436 SEA 444 EA Sbjct: 125 VEA 127
>U2AF2_SCHPO (P36629) Splicing factor U2AF 59 kDa subunit (U2 auxiliary factor| 59 kDa subunit) (U2 snRNP auxiliary factor large subunit) (U2AF59) Length = 517 Score = 33.9 bits (76), Expect = 0.21 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + + N+PL+ + + + FG + L K+ G +GF F EF +P DA A Sbjct: 312 IYISNLPLNLGEDQVVELLKPFGDLLSFQLIKNIADGSSKGFCFCEFKNPSDAEVA 367
>RBM4_MOUSE (Q8C7Q4) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (mLark) Length = 361 Score = 33.9 bits (76), Expect = 0.21 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI + ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDY--------AFVHMERAEDA 124 Query: 436 SEA 444 EA Sbjct: 125 VEA 127
>RBM4B_RAT (Q64LC9) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) (Zinc-responsive protein ZD7) Length = 357 Score = 33.9 bits (76), Expect = 0.21 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI + ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDY--------AFVHMERAEDA 124 Query: 436 SEA 444 EA Sbjct: 125 VEA 127
>RBM4B_MOUSE (Q8VE92) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 357 Score = 33.9 bits (76), Expect = 0.21 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI + ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDY--------AFVHMERAEDA 124 Query: 436 SEA 444 EA Sbjct: 125 VEA 127
>RO32_XENLA (P51992) Heterogeneous nuclear ribonucleoprotein A3 homolog 2| (hnRNP A3(B)) Length = 385 Score = 33.9 bits (76), Expect = 0.21 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Frame = +1 Query: 277 LLVRNIPLSARAED-----LRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 L V+ I + ED LR FE +G + + + +D SG+ RGFAFV F D Sbjct: 115 LTVKKIFVGGIKEDTEEYHLRDYFEGYGKIETIEVMEDRQSGKKRGFAFVTFDD 168 Score = 30.4 bits (67), Expect = 2.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + + LR FE++G + D + +D + RGF FV + V+ DAS Sbjct: 29 LFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAS 84
>YG5B_YEAST (P53316) Hypothetical 89.5 kDa protein in MGA1-GCN4 intergenic| region Length = 781 Score = 33.9 bits (76), Expect = 0.21 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 G++ V I S +L F ++GP+ + L D GEP G+ F+ + Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISY 243 Score = 33.1 bits (74), Expect = 0.36 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 19/80 (23%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYL-------------------PKDYYS 384 Q +L V++IPLS EDL ++ FG + V + D Sbjct: 537 QQESNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPV 596 Query: 385 GEPRGFAFVEFVDPYDASEA 444 G RG+ FV F P DA++A Sbjct: 597 GSSRGYGFVSFESPLDAAKA 616
>PABP2_ARATH (P42731) Polyadenylate-binding protein 2 (Poly(A)-binding protein| 2) (PABP 2) Length = 629 Score = 33.9 bits (76), Expect = 0.21 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 ++ V+N+ S +DL+ F +G + + KD G+ +GF FV F + DA+ A Sbjct: 216 NVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKD-GEGKSKGFGFVNFENADDAARA 271 Score = 32.0 bits (71), Expect = 0.81 Identities = 16/63 (25%), Positives = 33/63 (52%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + G+G++ ++N+ S + L F FG + + D SG+ +G+ FV++ + A Sbjct: 119 RRSGAGNIFIKNLDESIDHKALHDTFSSFGNIVSCKVAVDS-SGQSKGYGFVQYANEESA 177 Query: 436 SEA 444 +A Sbjct: 178 QKA 180
>SART3_HUMAN (Q15020) Squamous cell carcinoma antigen recognized by T-cells 3| (SART-3) (hSART-3) (Tat-interacting protein of 110 kDa) (Tip110) Length = 963 Score = 33.9 bits (76), Expect = 0.21 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L + +P S E+L + G V+D+ L + +G+P+G A+VE+ + AS+A Sbjct: 803 LFISGLPFSCTKEELEEICKAHGTVKDLRLVTNR-AGKPKGLAYVEYENESQASQA 857
>SART3_PONPY (Q5REG1) Squamous cell carcinoma antigen recognized by T-cells 3| (SART-3) Length = 981 Score = 33.9 bits (76), Expect = 0.21 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L + +P S E+L + G V+D+ L + +G+P+G A+VE+ + AS+A Sbjct: 821 LFISGLPFSCTKEELEEICKAHGTVKDLRLVTNR-AGKPKGLAYVEYENESQASQA 875
>PPIL4_ASPOR (Q2U256) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 461 Score = 33.9 bits (76), Expect = 0.21 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 EDL + F RFG + + +D +G+ +AF+EF + D +A+ Sbjct: 262 EDLHLIFSRFGTILSCEVIRDKRTGDSLQYAFIEFENQKDCEQAY 306
>MSI1H_RAT (Q8K3P4) RNA-binding protein Musashi homolog 1 (Musashi-1)| Length = 362 Score = 33.9 bits (76), Expect = 0.21 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 + V + ++ ED++ FE+FG V D L D + RGF FV F Sbjct: 111 IFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 157 Score = 31.6 bits (70), Expect = 1.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E LR F +FG V++ + +D + RGF FV F+D Sbjct: 34 EGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD 70
>MSI1H_MOUSE (Q61474) RNA-binding protein Musashi homolog 1 (Musashi-1)| Length = 362 Score = 33.9 bits (76), Expect = 0.21 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 + V + ++ ED++ FE+FG V D L D + RGF FV F Sbjct: 111 IFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 157 Score = 31.6 bits (70), Expect = 1.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 E LR F +FG V++ + +D + RGF FV F+D Sbjct: 34 EGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD 70
>RNP24_SCHPO (Q09100) RNA-binding protein rnp24| Length = 369 Score = 33.9 bits (76), Expect = 0.21 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 K++ S L V N+ DL+ F + G +R V L +G+ +GF FV+F D Sbjct: 223 KKEPSSILFVGNLDFETTDADLKEHFGQVGQIRRVRLMTFEDTGKCKGFGFVDFPD 278
>YQO4_CAEEL (Q09295) Putative RNA-binding protein EEED8.4| Length = 237 Score = 33.9 bits (76), Expect = 0.21 Identities = 13/50 (26%), Positives = 29/50 (58%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 S+ + N+ ++ E++ F+ G + +PKD ++ + + FA++EF D Sbjct: 102 SVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIEFDD 151
>NOP3_YEAST (Q01560) Nucleolar protein 3 (Mitochondrial targeting suppressor 1| protein) (Nuclear polyadenylated RNA-binding protein 1) Length = 414 Score = 33.9 bits (76), Expect = 0.21 Identities = 21/62 (33%), Positives = 31/62 (50%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 E + L VR PL + +L F FGP+++V + GFAFVEF + A+ Sbjct: 121 ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAESAA 172 Query: 439 EA 444 +A Sbjct: 173 KA 174
>YP85_CAEEL (Q09442) Putative RNA-binding protein C08B11.5| Length = 388 Score = 33.5 bits (75), Expect = 0.28 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +1 Query: 343 GPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 GPV V +PKD + +GF FVEF+ DA A Sbjct: 37 GPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYA 70
>TXA11_ANTEL (P0C1F0) Toxin APE 1-1| Length = 47 Score = 33.5 bits (75), Expect = 0.28 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = -2 Query: 163 IPSLGDYDVQGYRHNPSSGDYGVGGCTSSWYCCAWSGERPG 41 I L D D R N SG Y + GC S W+ C SG+ G Sbjct: 2 IACLCDSDGPSVRGNTLSGTYWLAGCPSGWHNCKSSGQLIG 42
>PPIL4_CRYNE (Q5KNY5) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 504 Score = 33.5 bits (75), Expect = 0.28 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 EDL + F RFG + + +D SG+ +AF+EF + A +A+ Sbjct: 260 EDLELIFSRFGKILSCEVVRDKKSGDSLQYAFIEFDEREAAEQAY 304
>ROA1_BOVIN (P09867) Heterogeneous nuclear ribonucleoprotein A1| (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) (Unwinding protein 1) (UP1) (Fragment) Length = 195 Score = 33.5 bits (75), Expect = 0.28 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I LR FE++G + + + D SG+ RGFAFV F D Sbjct: 106 IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDD 154 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + E LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 15 LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA 70
>MINT_MOUSE (Q62504) Msx2-interacting protein (SPEN homolog)| (SMART/HDAC1-associated repressor protein) Length = 3644 Score = 33.5 bits (75), Expect = 0.28 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDV-YLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 L V N+P + R E + F+R+G V V LPK E AFV+FVD A +AH Sbjct: 8 LWVGNLPENVREEKIIEHFKRYGRVESVKILPK--RGSEGGVAAFVDFVDIKSAQKAH 63 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/50 (32%), Positives = 30/50 (60%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 +L + N+ + DLR F+RFG + D+ + K +G P+ +AF+++ D Sbjct: 440 TLFIGNLEKTTTYHDLRNIFQRFGEIVDIDIKK--VNGVPQ-YAFLQYCD 486
>PABP_YEAST (P04147) Polyadenylate-binding protein, cytoplasmic and nuclear| (Poly(A)-binding protein) (PABP) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) Length = 576 Score = 33.5 bits (75), Expect = 0.28 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L V+NI E + F +FGP+ L KD G+ +GF FV + DA +A Sbjct: 219 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKA 274
>SART3_MOUSE (Q9JLI8) Squamous cell carcinoma antigen recognized by T-cells 3| (SART-3) (mSART-3) (Tumor-rejection antigen SART3) Length = 962 Score = 33.5 bits (75), Expect = 0.28 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L + +P S E+L + G V+D+ L + +G+P+G A+VE+ + AS+A Sbjct: 803 LFISGLPFSCTKEELEDICKAHGTVKDLRLVTNR-AGKPKGLAYVEYENESQASQA 857
>PPIL4_EMENI (Q5ARI5) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 461 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 EDL + F RFG + + +D +G+ +AF+EF D +A+ Sbjct: 262 EDLELIFSRFGKILSCEVIRDKRTGDSLQYAFIEFESQKDCEQAY 306
>MINT_HUMAN (Q96T58) Msx2-interacting protein (SPEN homolog)| (SMART/HDAC1-associated repressor protein) Length = 3664 Score = 33.5 bits (75), Expect = 0.28 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDV-YLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 L V N+P + R E + F+R+G V V LPK E AFV+FVD A +AH Sbjct: 8 LWVGNLPENVREEKIIEHFKRYGRVESVKILPK--RGSEGGVAAFVDFVDIKSAQKAH 63 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/50 (32%), Positives = 30/50 (60%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 +L + N+ + DLR F+RFG + D+ + K +G P+ +AF+++ D Sbjct: 439 TLFIGNLEKTTTYHDLRNIFQRFGEIVDIDIKK--VNGVPQ-YAFLQYCD 485
>RU17_YEAST (Q00916) U1 small nuclear ribonucleoprotein 70 kDa homolog| Length = 300 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 ++ + +P +L+ F +FG + + + KD + + +G+AF+ F DP + A Sbjct: 108 TIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMA 164
>ROA1_SCHAM (P21522) Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog| Length = 342 Score = 33.5 bits (75), Expect = 0.28 Identities = 21/52 (40%), Positives = 27/52 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYD 432 L V I DLR F+++G V + D + + RGFAFVEF D YD Sbjct: 110 LFVGGIKEEMEENDLRDYFKQYGTVVSAAIVVDKETRKKRGFAFVEF-DDYD 160 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 L + + E L+ FE++G + DV + KD + RGF F+ + Sbjct: 19 LFIGGLDYRTTDESLKQHFEQWGEIVDVVVMKDPKTKRSRGFGFITY 65
>ROA1_HUMAN (P09651) Heterogeneous nuclear ribonucleoprotein A1| (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Length = 371 Score = 33.5 bits (75), Expect = 0.28 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I LR FE++G + + + D SG+ RGFAFV F D Sbjct: 106 IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDD 154 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + E LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 15 LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA 70
>ROA1_RAT (P04256) Heterogeneous nuclear ribonucleoprotein A1| (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) (HDP) Length = 319 Score = 33.5 bits (75), Expect = 0.28 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I LR FE++G + + + D SG+ RGFAFV F D Sbjct: 106 IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDD 154 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + E LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 15 LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA 70
>ROA1_MOUSE (P49312) Heterogeneous nuclear ribonucleoprotein A1| (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) Length = 319 Score = 33.5 bits (75), Expect = 0.28 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I LR FE++G + + + D SG+ RGFAFV F D Sbjct: 106 IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDD 154 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + E LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 15 LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA 70
>ROA1_MACMU (Q28521) Heterogeneous nuclear ribonucleoprotein A1| (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) Length = 319 Score = 33.5 bits (75), Expect = 0.28 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V I LR FE++G + + + D SG+ RGFAFV F D Sbjct: 106 IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDD 154 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + E LR FE++G + D + +D + RGF FV + V+ DA+ Sbjct: 15 LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEKVDAA 70
>RBM7_HUMAN (Q9Y580) RNA-binding protein 7 (RNA-binding motif protein 7)| Length = 266 Score = 33.1 bits (74), Expect = 0.36 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +L V N+ E L F + GPV V +PKD G+P+ FAFV F Sbjct: 11 TLFVGNLETKVTEELLFELFHQAGPVIKVKIPKD-KDGKPKQFAFVNF 57
>CTF1_SCHPO (O43040) Cleavage and termination factor 1 (Transcription| termination factor ctf1) Length = 363 Score = 33.1 bits (74), Expect = 0.36 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + V NIP + + F + GPV+ L D +G +G+ F EF D Sbjct: 9 VFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFD 57
>RBM7_BOVIN (Q3MHY8) RNA-binding protein 7 (RNA-binding motif protein 7)| Length = 262 Score = 33.1 bits (74), Expect = 0.36 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +L V N+ E L F + GPV V +PKD G+P+ FAFV F Sbjct: 11 TLFVGNLETKVTEELLFELFHQAGPVIKVKIPKD-KDGKPKQFAFVNF 57
>MK67I_XENTR (Q6GL69) MKI67 FHA domain-interacting nucleolar phosphoprotein-like| Length = 276 Score = 33.1 bits (74), Expect = 0.36 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 G + + +IP + LR F +FG V + L + +G +G+A+VEF Sbjct: 41 GVIYIGHIPRALYEPQLREYFSQFGTVTRLRLSRSKKTGNSKGYAYVEF 89
>PABP_DROME (P21187) Polyadenylate-binding protein (Poly(A)-binding protein)| (PABP) Length = 634 Score = 33.1 bits (74), Expect = 0.36 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 SL V ++P L F GPV + + +D + G+A+V F P DA A Sbjct: 3 SLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERA 59
>ROC1_NICSY (Q08935) 29 kDa ribonucleoprotein A, chloroplast precursor (CP29A)| Length = 273 Score = 33.1 bits (74), Expect = 0.36 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFV 411 + V N+P SA + L FER G V V + D +G RGF FV Sbjct: 89 IFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFV 133
>ROC2_NICPL (P49314) 31 kDa ribonucleoprotein, chloroplast precursor (CP-RBP31)| Length = 292 Score = 33.1 bits (74), Expect = 0.36 Identities = 20/45 (44%), Positives = 23/45 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFV 411 L V N+P S + L FER G V V + D SG RGF FV Sbjct: 90 LFVGNLPFSVDSAALAGLFERAGNVEIVEVIYDKLSGRSRGFGFV 134
>RBM4_HUMAN (Q9BWF3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (hLark) Length = 364 Score = 32.7 bits (73), Expect = 0.47 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI + ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDY--------AFVHMERAEDA 124 Query: 436 SEA 444 EA Sbjct: 125 VEA 127
>NUCL_PONPY (Q5RF26) Nucleolin| Length = 711 Score = 32.7 bits (73), Expect = 0.47 Identities = 20/59 (33%), Positives = 36/59 (61%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S +L++ N+ SA E L+ FE+ ++ +P++ +G+ +G+AF+EF DA EA Sbjct: 486 SKTLVLSNLSYSATEETLQEVFEKATFIK---VPQNQ-NGKSKGYAFIEFASFEDAKEA 540 Score = 28.5 bits (62), Expect = 8.9 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q S +L V+ + E L+ F+ G VR + D +G +GF FV+F DA Sbjct: 568 RSQPSKTLFVKGLSEDTTEETLKESFD--GSVR-ARIVTDRETGSSKGFGFVDFNSEEDA 624 Query: 436 SEA 444 A Sbjct: 625 KAA 627
>NUCL_MACFA (Q4R4J7) Nucleolin| Length = 710 Score = 32.7 bits (73), Expect = 0.47 Identities = 20/59 (33%), Positives = 36/59 (61%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S +L++ N+ SA E L+ FE+ ++ +P++ +G+ +G+AF+EF DA EA Sbjct: 485 SKTLVLSNLSYSATEETLQEVFEKATFIK---VPQNQ-NGKSKGYAFIEFASFEDAKEA 539 Score = 28.5 bits (62), Expect = 8.9 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q S +L V+ + E L+ F+ G VR + D +G +GF FV+F DA Sbjct: 567 RSQPSKTLFVKGLSEDTTEETLKESFD--GSVR-ARIVTDRETGSSKGFGFVDFNSEEDA 623 Query: 436 SEA 444 A Sbjct: 624 KAA 626
>DAZ1_CAEEL (Q20870) DAZ protein 1| Length = 499 Score = 32.7 bits (73), Expect = 0.47 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 + V P S +LR FE+F V+DV + K G+ +G+ F+ F A E Sbjct: 69 IFVGGFPTSTTETELREHFEKFFAVKDVKMVKS-LDGQSKGYGFITFETEDQAEE 122
>YQOC_CAEEL (Q09301) Putative RNA-binding protein EEED8.12| Length = 197 Score = 32.7 bits (73), Expect = 0.47 Identities = 13/50 (26%), Positives = 29/50 (58%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 S+ + N+ ++ E++ F+ G + +PKD ++ + + FA++EF D Sbjct: 62 SVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDD 111
>RBM4_BOVIN (Q3MHX3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) Length = 362 Score = 32.7 bits (73), Expect = 0.47 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 K + S L V NI + ++LR FE +GPV + + KDY AFV DA Sbjct: 73 KSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDY--------AFVHMERAEDA 124 Query: 436 SEA 444 EA Sbjct: 125 VEA 127
>NUCL_HUMAN (P19338) Nucleolin (Protein C23)| Length = 709 Score = 32.7 bits (73), Expect = 0.47 Identities = 20/59 (33%), Positives = 36/59 (61%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S +L++ N+ SA E L+ FE+ ++ +P++ +G+ +G+AF+EF DA EA Sbjct: 484 SKTLVLSNLSYSATEETLQEVFEKATFIK---VPQNQ-NGKSKGYAFIEFASFEDAKEA 538 Score = 28.5 bits (62), Expect = 8.9 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q S +L V+ + E L+ F+ G VR + D +G +GF FV+F DA Sbjct: 566 RSQPSKTLFVKGLSEDTTEETLKESFD--GSVR-ARIVTDRETGSSKGFGFVDFNSEEDA 622 Query: 436 SEA 444 A Sbjct: 623 KAA 625
>NSR1_YEAST (P27476) Nuclear localization sequence-binding protein (P67)| Length = 414 Score = 32.7 bits (73), Expect = 0.47 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S +L + N+ +A + + F + G V V +P + +P+GF +V+F + DA +A Sbjct: 266 SDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKA 324
>DND1_BRARE (Q7T1H5) Dead end protein 1| Length = 411 Score = 32.3 bits (72), Expect = 0.62 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 265 GSG-SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 GSG + + IP + L F+ G + + L ++ SG+ RGFA+ ++ DP AS Sbjct: 57 GSGCEVFISQIPNDVYEDRLIPLFQSIGTIYEFRLMMNF-SGQTRGFAYAKYGDPLTASA 115 Query: 442 AHIT 453 A T Sbjct: 116 AVTT 119
>RBM11_HUMAN (P57052) Putative RNA-binding protein 11 (RNA-binding motif protein| 11) Length = 281 Score = 32.3 bits (72), Expect = 0.62 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 +E+ ++ V N+ R E L F + GP+ V + KD G+P+ F FV F P Sbjct: 5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDR-EGKPKSFGFVCFKHPESV 63 Query: 436 SEA 444 S A Sbjct: 64 SYA 66
>PABPX_ARATH (Q9ZQA8) Probable polyadenylate-binding protein At2g36660| (Poly(A)-binding protein At2g36660) (PABP) Length = 609 Score = 32.3 bits (72), Expect = 0.62 Identities = 20/62 (32%), Positives = 32/62 (51%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 E+ +L ++N+ + LR F FG + + + KD + RG+AFV F +P DA Sbjct: 197 EEKYTNLYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDE-NRLCRGYAFVNFDNPEDAR 255 Query: 439 EA 444 A Sbjct: 256 RA 257 Score = 32.0 bits (71), Expect = 0.81 Identities = 20/65 (30%), Positives = 35/65 (53%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + G G++ V+N+P S L+ F++FG + + G+ RG+ FV+F + DA Sbjct: 107 RRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKV-ATLEDGKSRGYGFVQF-EQEDA 164 Query: 436 SEAHI 450 + A I Sbjct: 165 AHAAI 169
>NUCL_MESAU (P08199) Nucleolin (Protein C23)| Length = 713 Score = 32.3 bits (72), Expect = 0.62 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S +L++ N+ SA E L+ FE+ ++ +P++ G+ +G+AF+EF DA EA Sbjct: 484 SKTLVLSNLSYSATEETLQEVFEKATFIK---VPQNQ-QGKSKGYAFIEFASFEDAKEA 538 Score = 29.6 bits (65), Expect = 4.0 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q S +L V+ + E L+ FE G VR + D +G +GF FV+F DA Sbjct: 566 RSQPSKTLFVKGLSEDTTEETLKESFE--GSVR-ARIVTDRETGSSKGFGFVDFNSEEDA 622 Query: 436 SEA 444 A Sbjct: 623 KAA 625
>RNP4F_DROME (Q9W4D2) RNA-binding protein 4F| Length = 941 Score = 32.3 bits (72), Expect = 0.62 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 + VRN+ + E+L F FG ++DV L + + +G A+VEF P +A A Sbjct: 726 IFVRNLHPACSKEELHELFSPFGTIKDVRLVHK-LNKQFKGIAYVEFEKPGEAQRA 780
>NUCL_RAT (P13383) Nucleolin (Protein C23)| Length = 712 Score = 32.3 bits (72), Expect = 0.62 Identities = 20/59 (33%), Positives = 36/59 (61%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S +L++ N+ SA E L+ FE+ ++ +P++ + G+ +G+AF+EF DA EA Sbjct: 487 SKTLVLSNLSYSATEETLQEVFEKATFIK---VPQNPH-GKSKGYAFIEFASFEDAKEA 541 Score = 29.6 bits (65), Expect = 4.0 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDA 435 + Q S +L V+ + E L+ FE G VR + D +G +GF FV+F DA Sbjct: 569 RSQPSKTLFVKGLSEDTTEETLKESFE--GSVR-ARIVTDRETGSSKGFGFVDFNSEEDA 625 Query: 436 SEA 444 A Sbjct: 626 KAA 628
>RAVR2_HUMAN (Q9HCJ3) Protein raver-2| Length = 691 Score = 32.3 bits (72), Expect = 0.62 Identities = 14/58 (24%), Positives = 30/58 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAHI 450 L + N+P+S +E+ +G + +L +G +G+ FVE++ A++A + Sbjct: 144 LCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARL 201
>GRP1_DAUCA (Q03878) Glycine-rich RNA-binding protein| Length = 157 Score = 32.3 bits (72), Expect = 0.62 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 E L F +FG + D + D +G RGF FV F D +A Sbjct: 20 ESLEQAFSQFGDITDSKIINDRETGRSRGFGFVTFKDEKSMRDA 63
>U2AF2_MOUSE (P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor| 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) Length = 475 Score = 32.0 bits (71), Expect = 0.81 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 L + +P + ++ FGP++ L KD +G +G+AF E+VD Sbjct: 261 LFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVD 309
>U2AF2_HUMAN (P26368) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor| 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) (hU2AF(65)) Length = 475 Score = 32.0 bits (71), Expect = 0.81 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 L + +P + ++ FGP++ L KD +G +G+AF E+VD Sbjct: 261 LFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVD 309
>CECR6_MOUSE (Q99MX7) Cat eye syndrome critical region protein 6 homolog| Length = 572 Score = 32.0 bits (71), Expect = 0.81 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 133 GYRHNPSSGDYGVGGCTSSWYCCAWSGERPGRSAAAGVRRG 11 G R +G G GG S CC RP RS G RRG Sbjct: 145 GSRSAVGAGGTGTGGAASCCSCCCCCCGRPTRSGRRGRRRG 185
>ROC2_NICSY (Q08937) 29 kDa ribonucleoprotein B, chloroplast precursor (CP29B)| Length = 291 Score = 32.0 bits (71), Expect = 0.81 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFV 411 L V N+P S + L FER G V V + D +G RGF FV Sbjct: 89 LFVGNLPFSVDSAALAGLFERAGNVEMVEVIYDKLTGRSRGFGFV 133
>RX21_DROME (Q24491) RNA-binding protein Rsf1 (RNA-binding protein Rox21)| Length = 197 Score = 32.0 bits (71), Expect = 0.81 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +1 Query: 259 EQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 +Q + V N+ + +DL F ++G + V++ + P GFAFVEF DA Sbjct: 3 DQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWI-----AFNPPGFAFVEFEHRDDAE 57 Query: 439 EA 444 +A Sbjct: 58 KA 59
>NOP12_ASHGO (Q75BJ7) Nucleolar protein 12| Length = 426 Score = 31.6 bits (70), Expect = 1.1 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S+ V N+ E L F GP+ V + +D + +GFA+V+F D ++A Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKA 316
>PABP3_ARATH (O64380) Polyadenylate-binding protein 3 (Poly(A)-binding protein| 3) (PABP 3) Length = 660 Score = 31.6 bits (70), Expect = 1.1 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 ++ V+N+P ++LR F +FG + + +D SG R F FV F Sbjct: 230 NVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRD-QSGNSRCFGFVNF 276
>TRA2_DROVI (O02008) Transformer-2 sex-determining protein| Length = 272 Score = 31.6 bits (70), Expect = 1.1 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 262 QGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 Q S + V + + + +R F +FGP+ + + D ++ RGF F+ F + DA Sbjct: 102 QASRCIGVFGLNTNTTQQKVRELFNKFGPIERIQMVIDAHTHRSRGFCFIYFENLGDARV 161 Query: 442 A 444 A Sbjct: 162 A 162
>ELAV1_MOUSE (P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like| generic protein) (MelG) Length = 326 Score = 31.6 bits (70), Expect = 1.1 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L + +P + +D+ F RFG + + + D +G RG AF+ F +A EA Sbjct: 107 NLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEA 163
>ELAV1_HUMAN (Q15717) ELAV-like protein 1 (Hu-antigen R) (HuR)| Length = 326 Score = 31.6 bits (70), Expect = 1.1 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L + +P + +D+ F RFG + + + D +G RG AF+ F +A EA Sbjct: 107 NLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEA 163
>RAVR2_MOUSE (Q7TPD6) Protein raver-2| Length = 673 Score = 31.2 bits (69), Expect = 1.4 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAHI 450 L + N+P+S E+ +G + +L +G +G+ FVE++ A++A + Sbjct: 133 LCITNLPISFTLEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARL 190
>NONO_RAT (Q5FVM4) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 476 Score = 31.2 bits (69), Expect = 1.4 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFV 411 L V N+P E++R FE++G +V++ KD +GF F+ Sbjct: 81 LFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKD------KGFGFI 119
>HNRPD_RAT (Q9JJ54) Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0)| (AU-rich element RNA-binding protein 1) Length = 353 Score = 31.2 bits (69), Expect = 1.4 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +DL+ F +FG V D L D +G RGF FV F Sbjct: 109 KDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLF 143 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 E +R F FG V + LP D + + RGF F+ F Sbjct: 194 EKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF 228
>RBM23_HUMAN (Q86U06) Probable RNA-binding protein 23 (RNA-binding motif protein| 23) (RNA-binding region-containing protein 4) (Splicing factor SF2) Length = 439 Score = 31.2 bits (69), Expect = 1.4 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 256 KEQGSGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 +E+ + ++ + R DL F G VRDV + D S +G A+VEF + Sbjct: 161 EERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE 216
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 31.2 bits (69), Expect = 1.4 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFV 411 L V N+P E++R FE++G +V++ KD +GF F+ Sbjct: 76 LFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKD------KGFGFI 114
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 31.2 bits (69), Expect = 1.4 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFV 411 L V N+P E++R FE++G +V++ KD +GF F+ Sbjct: 76 LFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKD------KGFGFI 114
>DLX2A_BRARE (P50574) Homeobox protein Dlx2a (DLX-2) (Distal-less homeobox gene| 2a) Length = 270 Score = 31.2 bits (69), Expect = 1.4 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 297 WDVADQEXXXXXXXXXXXXTPPRGTSSSATISPPWGAAVRGAATISPP 154 WD A + +PP T+ S + PW ++ AA + PP Sbjct: 210 WDFAHSQRMNTVNSGLSQSSPPNSTTPSFLTNYPWYSSTNSAAHLQPP 257
>IST3_YEAST (P40565) U2 snRNP component IST3 (U2 snRNP protein SNU17)| (Increased sodium tolerance protein 3) Length = 148 Score = 31.2 bits (69), Expect = 1.4 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 + + N+ D+ F +G DV L +D +GE +GFA++++ D Sbjct: 33 IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYED 81
>HNRPD_MOUSE (Q60668) Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0)| (AU-rich element RNA-binding protein 1) Length = 355 Score = 31.2 bits (69), Expect = 1.4 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +DL+ F +FG V D L D +G RGF FV F Sbjct: 111 KDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLF 145 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 E +R F FG V + LP D + + RGF F+ F Sbjct: 196 EKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF 230
>HNRPD_HUMAN (Q14103) Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0)| (AU-rich element RNA-binding protein 1) Length = 355 Score = 31.2 bits (69), Expect = 1.4 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 +DL+ F +FG V D L D +G RGF FV F Sbjct: 111 KDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLF 145 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 E +R F FG V + LP D + + RGF F+ F Sbjct: 196 EKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF 230
>RO31_XENLA (P51968) Heterogeneous nuclear ribonucleoprotein A3 homolog 1| (hnRNP A3(A)) Length = 373 Score = 31.2 bits (69), Expect = 1.4 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Frame = +1 Query: 277 LLVRNIPLSARAED-----LRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVD 423 L V+ I + ED LR E +G + + + +D SG+ RGFAFV F D Sbjct: 115 LTVKKIFVGGIKEDTEEYHLRDYSESYGKIETIEVMEDRQSGKKRGFAFVTFDD 168 Score = 30.4 bits (67), Expect = 2.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF--VDPYDAS 438 L + + + LR FE++G + D + +D + RGF FV + V+ DAS Sbjct: 29 LFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAS 84
>PPIE_SCHMA (Q26548) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) Length = 273 Score = 31.2 bits (69), Expect = 1.4 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 364 LPKDYYSGEPRGFAFVEFVDPYDASEA 444 +P DY + + RGFAFVEF + DA A Sbjct: 1 MPMDYQTEKHRGFAFVEFEEVEDAMSA 27
>MK67I_XENLA (Q7SYS2) MKI67 FHA domain-interacting nucleolar phosphoprotein-like| Length = 278 Score = 31.2 bits (69), Expect = 1.4 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 G + + +IP S L+ F +FG V + L + +G +G+A+VE+ Sbjct: 41 GVIYIGHIPKSLIEPQLQEYFNQFGTVTRLRLSRSKKTGNSKGYAYVEY 89
>GRP2_ARATH (Q9SVM8) Glycine-rich RNA-binding protein 2, mitochondrial| precursor (AtGRP2) Length = 158 Score = 31.2 bits (69), Expect = 1.4 Identities = 20/59 (33%), Positives = 25/59 (42%) Frame = +1 Query: 268 SGSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 S L + + LR F FG V D + D +G RGF FV F D A+ A Sbjct: 34 STKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAA 92
>NONO_MOUSE (Q99K48) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 473 Score = 31.2 bits (69), Expect = 1.4 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFV 411 L V N+P E++R FE++G +V++ KD +GF F+ Sbjct: 78 LFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKD------KGFGFI 116
>MK67I_BRARE (Q8JIY8) MKI67 FHA domain-interacting nucleolar phosphoprotein-like| (Nucleolar phosphoprotein NOPP34-like protein) Length = 269 Score = 30.8 bits (68), Expect = 1.8 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 G L V ++P L+ FE+FG V + + + +G +G+ FVEF Sbjct: 45 GVLYVGHLPRGLFEPQLKSYFEQFGKVLRLRVSRSKKTGGSKGYGFVEF 93
>GRP10_BRANA (Q05966) Glycine-rich RNA-binding protein 10| Length = 169 Score = 30.8 bits (68), Expect = 1.8 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 316 DLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 +L F +FG V D + D +G RGF FV F D +A Sbjct: 21 ELERTFSQFGEVIDSKIINDRETGRSRGFGFVTFKDEKSMKDA 63
>PPIL4_SCHPO (Q9UUE4) Peptidyl-prolyl cis-trans isomerase cyp6 (EC 5.2.1.8)| (PPIase cyp6) (Rotamase cyp8) Length = 432 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 EDL + F RFG + + +D +G+ +AF+EF + +A+ Sbjct: 258 EDLELIFSRFGKIISCQVIRDKETGDSLQYAFIEFDNKESVEKAY 302
>PPIL4_GIBZE (Q4IE79) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 605 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAH 447 EDL + F RFG + + +D +G+ +AF+E+ D A+ Sbjct: 265 EDLELIFGRFGKILSCEVIRDQKTGDSLQYAFIEYEDKASCEAAY 309
>RBM8A_MOUSE (Q9CWZ3) RNA-binding protein 8A (RNA-binding motif protein 8A)| (Ribonucleoprotein RBM8A) Length = 174 Score = 30.8 bits (68), Expect = 1.8 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L V + A ED+ F +G +++++L D +G +G+ VE+ + Y ++A Sbjct: 75 LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEY-ETYKEAQA 129
>RBM8A_HUMAN (Q9Y5S9) RNA-binding protein 8A (RNA-binding motif protein 8A)| (Ribonucleoprotein RBM8A) (RNA-binding protein Y14) (Binder of OVCA1-1) (BOV-1) Length = 174 Score = 30.8 bits (68), Expect = 1.8 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L V + A ED+ F +G +++++L D +G +G+ VE+ + Y ++A Sbjct: 75 LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEY-ETYKEAQA 129
>ZCH14_MOUSE (Q8VIG0) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 956 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 42 PGRSPDHAQQYHEEVQPPTP*SPEEG 119 PGRS HA + EV+PP P EG Sbjct: 396 PGRSSSHASELRVEVEPPAHQLPREG 421
>CIC_MOUSE (Q924A2) Protein capicua homolog| Length = 1606 Score = 30.4 bits (67), Expect = 2.3 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = +3 Query: 12 PLRTPAAADLPGRSPDHAQQYHEEVQPPTP*SPEEGLWR*PCTS*SPKEGIWWQPPAPQP 191 P+ TP+ A P + + +V PP P PE G P + W P P P Sbjct: 1545 PVPTPSPAGGPDPTSPGSDSGTAQVAPPLPPPPEPG----------PGQPGWEGAPQPSP 1594 Query: 192 PKEG 203 P G Sbjct: 1595 PPSG 1598
>FCA_ARATH (O04425) Flowering time control protein FCA| Length = 747 Score = 30.4 bits (67), Expect = 2.3 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 277 LLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 L V ++ A +++ F +FG V DVYL +D Y + RG FV++ Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYR-QSRGCGFVKY 258
>GGA3_HUMAN (Q9NZ52) ADP-ribosylation factor-binding protein GGA3| (Golgi-localized, gamma ear-containing, ARF-binding protein 3) Length = 723 Score = 30.4 bits (67), Expect = 2.3 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = -3 Query: 234 PRGTSSSATISPPWGAAVRGAATISPPWGTTMCRATAITPPRGTTVWGAVPPH 76 P +SS A + PP+ A V A+ +P G+++ +T + P V AVP H Sbjct: 452 PSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLF-STGVAPALAPKVEPAVPGH 503
>HSH49_YEAST (Q99181) Protein HSH49| Length = 213 Score = 30.4 bits (67), Expect = 2.3 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +1 Query: 274 SLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 ++ V NI E L F + PV + PKD +G+AF+EF + DA A Sbjct: 10 TVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66
>HNRU2_HUMAN (P07029) Heterogeneous nuclear ribonucleoprotein UP2 (Fragment)| Length = 225 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 E +R F FG V + LP D + + RGF F+ F Sbjct: 186 EKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF 220
>HNRPC_RAT (P17132) Heterogeneous nuclear ribonucleoprotein C (hnRNP C) (hnRNP| core protein C) (Fragment) Length = 158 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 313 EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 E +R F FG V + LP D + + RGF F+ F Sbjct: 48 EKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF 82
>YG41_SCHPO (O60176) Hypothetical RNA-binding protein C23E6.01c in chromosome| II Length = 473 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 343 GPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 G V L ++ Y+G G+ FVEF P++AS A Sbjct: 117 GKAVKVKLIRNRYTGMNAGYCFVEFASPHEASSA 150
>RBM10_RAT (P70501) RNA-binding protein 10 (RNA-binding motif protein 10)| (S1-1 protein) Length = 852 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +1 Query: 352 RDVYLPKDYYSGEPRGFAFVEFVDPYDAS 438 R+V L ++ SG+ RGFAFVEF DA+ Sbjct: 80 REVRLMRNKSSGQSRGFAFVEFSHLQDAT 108
>HMWP2_YEREN (P48633) High-molecular-weight protein 2 (HMWP2)| Length = 2035 Score = 30.0 bits (66), Expect = 3.1 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = +3 Query: 57 DHAQQYHEEVQPPTP*SPEEGLWR*PCTS*SPKEGIWWQ------PPAPQPP 194 +H +Y +++ PP P + + L + S +P WWQ PPAP P Sbjct: 1637 EHGYRYPQQLLPPLPVTFRDYLQQPSLQSPNPDSLAWWQAQLDDIPPAPALP 1688
>MK67I_HUMAN (Q9BYG3) MKI67 FHA domain-interacting nucleolar phosphoprotein| (Nucleolar protein interacting with the FHA domain of pKI-67) (hNIFK) (Nucleolar phosphoprotein Nopp34) Length = 293 Score = 30.0 bits (66), Expect = 3.1 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 271 GSLLVRNIPLSARAEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 417 G + VR++P + F +FG V L + +G +G+AFVEF Sbjct: 45 GVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEF 93
>ROA0_HUMAN (Q13151) Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0)| Length = 305 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +1 Query: 316 DLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASE 441 DL F +FG V + D SG+ RGF FV F + +DA++ Sbjct: 113 DLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQN-HDAAD 153
>GRP2_SINAL (P49311) Glycine-rich RNA-binding protein GRP2A| Length = 169 Score = 30.0 bits (66), Expect = 3.1 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 319 LRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEA 444 L F +FG + D + D +G RGF FV F D +A Sbjct: 24 LETAFSQFGELVDSKIINDRETGRSRGFGFVTFKDEKSMKDA 65 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,765,255 Number of Sequences: 219361 Number of extensions: 1816645 Number of successful extensions: 6278 Number of sequences better than 10.0: 296 Number of HSP's better than 10.0 without gapping: 5596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6219 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
