ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast40d12 |
|---|---|
| Clone Library Name | barley_pub |
>LRP1_HHV1F (P17588) Latency-related protein 1| Length = 340 Score = 33.9 bits (76), Expect = 0.095 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 20 PDPTHTHTHAPNAP-APLVSYQSRPTDTLRRAPPPNGRH 133 P PTH H+HAP P P S+ L RAP P H Sbjct: 27 PTPTHPHSHAPPLPRTPTPSHPHSRAPPLPRAPTPTHPH 65 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 20 PDPTHTHTHAPNAPAPLVSYQSRPTDTLRR 109 P PTH H+HAP P + + PT T +R Sbjct: 59 PTPTHPHSHAPPLPR---TPEIHPTQTGKR 85
>VG42_BPMU (Q9T1V6) Protein gp42| Length = 690 Score = 32.0 bits (71), Expect = 0.36 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -3 Query: 117 GGALRSVSVGRLW*LTRGAGALGAWVWVWVGSGRALS 7 G L ++GR+ +T+GAGALG W+ G+GRALS Sbjct: 531 GNKLAGSAIGRV--VTKGAGALG---WMGKGAGRALS 562
>LRP2_HHV1F (P17589) Latency-related protein 2| Length = 107 Score = 31.2 bits (69), Expect = 0.62 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 20 PDPTHTHTHAPNAP-APLVSYQSRPTDTLRRAPPPNGRH 133 P PTH H+HAP P P ++ L R P P H Sbjct: 9 PTPTHPHSHAPPLPRTPTPAHPHSHAPPLPRTPTPTHPH 47
>SIF2_DROME (P91620) Protein still life, isoforms C/SIF type 2| Length = 2061 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 10 QSSARSHPHPHPRTQCARAPRELPEPTDR 96 Q A +HPHPHP PRE P P R Sbjct: 1930 QGHAHAHPHPHPH------PREPPPPPIR 1952
>SIF1_DROME (P91621) Protein still life, isoform SIF type 1| Length = 2072 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 10 QSSARSHPHPHPRTQCARAPRELPEPTDR 96 Q A +HPHPHP PRE P P R Sbjct: 1941 QGHAHAHPHPHPH------PREPPPPPIR 1963
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 13 SSARSHPHPHPRTQCARAPRELPEP 87 S SHPHPHP + P P+P Sbjct: 218 SHPHSHPHPHPHPHPHQIPHPHPQP 242
>DAPA1_WHEAT (P24846) Dihydrodipicolinate synthase 1, chloroplast precursor| (EC 4.2.1.52) (DHDPS 1) Length = 388 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 22 RSHPHPHPRTQCARAPRELPEP 87 R HPHPHP ++ +RA P P Sbjct: 8 RPHPHPHPTSRLSRASPPSPFP 29
>YEI4_YEAST (P39973) Hypothetical UPF0320 protein YEL074W| Length = 112 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 29 THTHTHAPNAPAPLVSYQSRPTDTLRRAPPPNGRH 133 THTHTH P +P+ + +Y +T ++P + +H Sbjct: 72 THTHTHTPCSPSLVYTY----VNTTEKSPSKSPKH 102
>LDB3_HUMAN (O75112) LIM domain-binding protein 3 (Z-band alternatively spliced| PDZ-motif protein) (Protein cypher) Length = 727 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 20 PDPTHTHTHAPNA-PAPLVSYQSRPTDTLRRAP 115 P P +T + APN PAP V+Y P + R P Sbjct: 457 PAPAYTPSPAPNYNPAPSVAYSGGPAEPASRPP 489
>ZN759_MOUSE (Q80VM4) Zinc finger protein 579| Length = 562 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 37 PHPRTQCARAPRELPEPTD--RHTAQ 108 P P +CA PR PEP RH AQ Sbjct: 98 PQPPLRCAACPRTFPEPAQLRRHLAQ 123
>ZN759_HUMAN (Q8NAF0) Zinc finger protein 579| Length = 562 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 37 PHPRTQCARAPRELPEPTD--RHTAQ 108 P P +CA PR PEP RH AQ Sbjct: 96 PQPPLRCAACPRTFPEPAQLRRHLAQ 121
>SPESP_MACFA (Q95LJ2) Sperm equatorial segment protein 1 precursor| Length = 352 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 31 PHPHPRTQCARAPRELPEPTDRHTAQSTTTERTP 132 P P P + APR LP T+ T+ T+ ++P Sbjct: 147 PEPEPTARQTEAPRTLPVVTESSTSPYVTSYKSP 180
>SPESP_HUMAN (Q6UW49) Sperm equatorial segment protein 1 precursor (SP-ESP)| (Equatorial segment protein) (ESP) (Glycosylated 38 kDa sperm protein C-7/8) Length = 350 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 31 PHPHPRTQCARAPRELPEPTDRHTAQSTTTERTP 132 P P P + APR LP T+ T+ T+ ++P Sbjct: 147 PEPEPAAKQTEAPRMLPVVTESSTSPYVTSYKSP 180
>CAC1E_MOUSE (Q61290) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2272 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 50 PNAPAPLVSYQSRPTDTLRRAPPPNGRHG 136 P P PL+SY S T +PPP+G G Sbjct: 2123 PPKPRPLLSYSSLMRHTGGISPPPDGSEG 2151
>WRK22_ARATH (O04609) WRKY transcription factor 22 (WRKY DNA-binding protein 22)| Length = 298 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 1 VTTQSSARSHPHPHPRTQCARAPRELPEPTDRHTAQSTTT 120 + T ++ +HP P R A + R+ +P+D+ T++S TT Sbjct: 176 IVTYTAEHNHPAPTHRNSLAGSTRQ--KPSDQQTSKSPTT 213
>PTP3_YEAST (P40048) Tyrosine-protein phosphatase 3 (EC 3.1.3.48)| (Protein-tyrosine phosphatase 3) (PTPase 3) Length = 928 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 44 HAPNAPAPLVSYQSRPTDTLRRAPPP 121 H+P A +PLVSY++ L+RA P Sbjct: 52 HSPKASSPLVSYKTSSPVLLKRATAP 77
>CAC1E_RAT (Q07652) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (RBE-II) (RBE2) (Brain calcium channel II) (BII) Length = 2222 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 50 PNAPAPLVSYQSRPTDTLRRAPPPNGRHG 136 P P PL+SY S T +PPP+G G Sbjct: 2072 PPKPRPLLSYSSLMRHTGGISPPPDGSEG 2100
>VGLD_PRVRI (P07645) Protein gp50| Length = 402 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 22 RSHPHPHPRTQCARAPRELPEPTDR-HTAQSTTTERTP 132 R P P P P LPEP R H A T R P Sbjct: 276 RPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPP 313
>TCRG1_HUMAN (O14776) Transcription elongation regulator 1 (TATA box-binding| protein-associated factor 2S) (Transcription factor CA150) Length = 1098 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 7 TQSSARSHPHPHPRTQCARAPRELPEPT 90 T + ++ P PHP+T P +P+PT Sbjct: 325 TATPVQTVPQPHPQTLPPAVPHSVPQPT 352
>ZO1_MOUSE (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1745 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 1 VTTQSSARSHPHPHPRTQCARAPRELPEPTDRHTAQS 111 + + S RSH P PR +R+P + EP+D H+ QS Sbjct: 295 LASDHSGRSHDRP-PRRSQSRSPDQRSEPSD-HSTQS 329
>IF2_BIFLO (Q8G3Y5) Translation initiation factor IF-2| Length = 954 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 11 RARPDPTHTHTHAPNAPAPLVSYQSRPTDTLRRAPPPNGRHGE 139 +A P H P AP P RP R P GRHG+ Sbjct: 89 QASPASAHQQAPTPGAPTP------RPQGGARPGMPTPGRHGQ 125
>CPSF5_XENLA (Q6DJE4) Cleavage and polyadenylation specificity factor 5| Length = 227 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +3 Query: 261 QGEWVYDEAA----RPAYEEAACPYIPAELT 341 Q +WV D+ RP +E PYIPA +T Sbjct: 136 QQDWVIDDCIGNWWRPNFEPPQYPYIPAHIT 166
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 32 HTHTHAPNAPAPLVSYQSRPTDTLRRAPPPNGRHG 136 H H PN P P + P + + P P G HG Sbjct: 411 HPMQHNPNGPPP--PWMQPPPPPMNQGPHPPGHHG 443
>CELR3_MOUSE (Q91ZI0) Cadherin EGF LAG seven-pass G-type receptor 3 precursor| Length = 3301 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 6/49 (12%) Frame = +2 Query: 5 LLRARPDPTHTHTHAPNA------PAPLVSYQSRPTDTLRRAPPPNGRH 133 LLRAR DP +H P+ + L S+ S +++ + P+G H Sbjct: 3216 LLRAREDPASGPSHGPSTEQLDILSSILASFNSSALSSVQSSSTPSGPH 3264
>IF2_STRCO (Q8CJQ8) Translation initiation factor IF-2| Length = 1033 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 26 PTHTHTHAPNAPAPLVSYQSRPTDTLRRAPPP 121 P AP+APAP S RPT + AP P Sbjct: 106 PAAQQPAAPSAPAPAPSQGPRPTPGPKPAPRP 137
>E2AK1_RAT (Q63185) Eukaryotic translation initiation factor 2-alpha kinase 1| (EC 2.7.11.1) (Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase) (Heme-regulated inhibitor) (Heme-controlled repressor) (HCR) (Hemin-sensitive initiation factor 2- Length = 620 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/32 (31%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +3 Query: 249 CDVGQGEWVYD--EAARPAYEEAACPYIPAEL 338 C++ +W+ + + +R +EAACPY+ A + Sbjct: 385 CELSLWDWIAERNKRSRKCVDEAACPYVMASV 416
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 32 HTHTHAPNAPAPLVSYQSRPTDTLRRAPPPNGRHG 136 H H PN P P + P + + P P G HG Sbjct: 411 HPMQHNPNGPPP--PWMQPPPPPMNQGPHPPGHHG 443
>EXTN2_ARATH (Q9M1G9) Extensin-2 precursor (AtExt2) (Cell wall| hydroxyproline-rich glycoprotein 1) (HRGP1) Length = 743 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 20 PDPTHTHTHAPNAPAPLVSYQSRPTDTLRRAPPP 121 P PT+T PAP V Y+S P + +PPP Sbjct: 56 PPPTYT-------PAPEVEYKSPPPPYVYSSPPP 82
>YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region| Length = 153 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 28 HPHPHPRTQCARAPRELPEPTDR---HTAQSTTT 120 HPHPHP T P P PT HT TT Sbjct: 25 HPHPHPHTPTHTHP-HTPTPTPHPHPHTPHPHTT 57
>IDGF3_DROME (Q8MLZ7) Chitinase-like protein Idgf3 precursor (Imaginal disk| growth factor protein 3) Length = 441 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 20 PDPTHTHTHAPNAPAP-LVSYQSRPTDTLRRAPPPNGRHG 136 P+P++T+ PNAP +V R RA NG HG Sbjct: 346 PNPSNTNARGPNAPVKRVVDPTKRYGSYAFRAADENGDHG 385
>V70K_TYMVA (P20131) 69 kDa protein| Length = 628 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 20 PDPTHTHTHAPNAPAPLVSYQSRPTDTLRRAPPPNG 127 P+ T P P P ++ RP L RAPP G Sbjct: 248 PNSTRDPPPRPITPGPFNTHGVRPLSVLPRAPPRRG 283
>PAK4_MOUSE (Q8BTW9) Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1)| (p21-activated kinase 4) (PAK-4) Length = 593 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +2 Query: 38 HTHAPNAP------APLVSYQSRPTDTLRRAPPP 121 HT APN P AP S SRP R AP P Sbjct: 225 HTMAPNGPSATGLAAPQSSSSSRPPTRARGAPSP 258
>CELR3_RAT (O88278) Cadherin EGF LAG seven-pass G-type receptor 3 precursor| (Multiple epidermal growth factor-like domains 2) Length = 3313 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 6/49 (12%) Frame = +2 Query: 5 LLRARPDPTHTHTHAPNA------PAPLVSYQSRPTDTLRRAPPPNGRH 133 LLRAR DP +H P+ + L S+ S +++ + P+G H Sbjct: 3224 LLRAREDPASGPSHGPSTEQLDILSSILASFNSSALSSVQSSSTPSGPH 3272
>CBIO2_STRAW (Q82B58) Putative cobalt import ATP-binding protein cbiO 2| Length = 561 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +2 Query: 20 PDPTHTHTHAPNAPAPLVSYQSRPTDTLRRAPPPN 124 P PT T T A APAP S RP +RAP P+ Sbjct: 276 PTPTATAT-ATAAPAPSPSRPRRPRLLRKRAPVPS 309
>GCS1_RAT (O88941) Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106)| (Glycoprotein-processing glucosidase I) Length = 834 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 117 GGALRSVSVGRLW*LTRGAGALGAWVWVWVGSGRALSSH 1 GGA +V V L G G WV W+G RAL+ H Sbjct: 40 GGAALAVVV-----LALAFGLSGRWVLAWLGVRRALTLH 73
>DVL3_HUMAN (Q92997) Segment polarity protein dishevelled homolog DVL-3| (Dishevelled-3) (DSH homolog 3) Length = 716 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 34 HPHPRTQCARAPRELPEPTDR 96 HP P CA P ELP P +R Sbjct: 85 HPDPAPFCADNPSELPPPMER 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.122 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,360,978 Number of Sequences: 219361 Number of extensions: 642824 Number of successful extensions: 2586 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 2223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2527 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)
