| Clone Name | bast40c04 |
|---|---|
| Clone Library Name | barley_pub |
>CCSA_ODOSI (P49523) Cytochrome c biogenesis protein ccsA| Length = 312 Score = 29.6 bits (65), Expect = 3.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 144 GKRAARIGDLGFALVWLARFGYRFL 70 GK+ A +G LGF ++W+ G FL Sbjct: 277 GKKTAILGGLGFFVIWICYLGVNFL 301
>FAS_HUMAN (P49327) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl- Length = 2511 Score = 29.6 bits (65), Expect = 3.0 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = -2 Query: 139 EGSSDWR-------FGVCVGLARPLRIPISAGHRGRDLYRKSWQGQRTGR 11 E S+DWR G+ G+ RPL+ + G + D +R QG+ G+ Sbjct: 1802 ESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGK 1851
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +2 Query: 2 PAPPTRSLPLPRFAIQIAAAVTSRNRYPKRASQTNA 109 PAP + SLPL I + V+S ++ P RASQ +A Sbjct: 219 PAPASGSLPLSAGGIGNSITVSSSSQPPARASQLHA 254
>CCSA_CYAPA (P48257) Cytochrome c biogenesis protein ccsA| Length = 322 Score = 28.5 bits (62), Expect = 6.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 144 GKRAARIGDLGFALVWLARFGYRFL 70 GK+AA + LGF ++W+ G L Sbjct: 287 GKKAAMVASLGFFIIWICYLGVNLL 311
>SGO1_YEAST (Q08490) Shugoshin| Length = 590 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +2 Query: 11 PTRSLPLPRFAIQIAAAVTSRNR---YPKRASQTNANPKSPIRAALFP 145 P+ LPLP T+ + YP +S TN++PK+ I+ ++ P Sbjct: 291 PSNPLPLPLPGPSATLPTTTSDASTVYPSSSSSTNSHPKTKIKHSMKP 338
>CCSA_PORPU (P51369) Cytochrome c biogenesis protein ccsA| Length = 319 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 144 GKRAARIGDLGFALVWLARFGYRFL 70 GKR A + +GF +VW+ G FL Sbjct: 284 GKRPAILASVGFLVVWICYLGVNFL 308
>LRP1B_MOUSE (Q9JI18) Low-density lipoprotein receptor-related protein 1B| precursor (Low-density lipoprotein receptor-related protein-deleted in tumor) (LRP-DIT) Length = 4599 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 1 TCPPYPFSAPATICDTDRGRGDQQKSVSEAGEPNQRKPQ 117 TC P+ F C D R D Q S+ + + KPQ Sbjct: 3475 TCGPHEFQCKNNNCIPDHWRCDNQNDCSDNSDEDNCKPQ 3513 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,074,978 Number of Sequences: 219361 Number of extensions: 722558 Number of successful extensions: 2208 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2208 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)