| Clone Name | bast40b11 |
|---|---|
| Clone Library Name | barley_pub |
>AMPL2_ARATH (Q8RX72) Leucine aminopeptidase 2, chloroplast precursor (EC| 3.4.11.1) (LAP 2) (Leucyl aminopeptidase 2) (Proline aminopeptidase 2) (EC 3.4.11.5) (Prolyl aminopeptidase 2) Length = 581 Score = 63.5 bits (153), Expect = 1e-10 Identities = 27/46 (58%), Positives = 41/46 (89%) Frame = +3 Query: 183 LGLTKANVVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDS 320 LGLT+AN V+ P+++F+GK+I+ ++WKGDILAV VTEKD++K ++S Sbjct: 65 LGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDANS 110
>AMPL3_ARATH (Q944P7) Leucine aminopeptidase 3, chloroplast precursor (EC| 3.4.11.1) (LAP 3) (Leucyl aminopeptidase 3) (Proline aminopeptidase 3) (EC 3.4.11.5) (Prolyl aminopeptidase 3) Length = 583 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/46 (58%), Positives = 40/46 (86%) Frame = +3 Query: 183 LGLTKANVVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDS 320 LGLT+AN V+ P+++F+GK+I+ ++WKGDILAV VTEKD++K +S Sbjct: 66 LGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDVNS 111
>AMPL1_ARATH (P30184) Leucine aminopeptidase 1 (EC 3.4.11.1) (LAP 1) (Leucyl| aminopeptidase 1) (Proline aminopeptidase 1) (EC 3.4.11.5) (Prolyl aminopeptidase 1) Length = 520 Score = 54.7 bits (130), Expect = 6e-08 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +3 Query: 183 LGLTKANVVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDS 320 LGLT+ N E +++FT K+I+ +WKGDIL V VTEKDL+K +S Sbjct: 5 LGLTQPNSTEPHKISFTAKEIDVIEWKGDILVVGVTEKDLAKDGNS 50
>AMPL2_LYCES (Q42876) Leucine aminopeptidase 2, chloroplast precursor (EC| 3.4.11.1) (LAP 2) (Leucyl aminopeptidase 2) (Proline aminopeptidase 2) (EC 3.4.11.5) (Prolyl aminopeptidase 2) Length = 569 Score = 52.4 bits (124), Expect = 3e-07 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = +3 Query: 183 LGLTKANVVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDS 320 LGLT N + P+++F K+I+ +WKGDIL V TEKDL++ +S Sbjct: 54 LGLTHTNQSDAPKISFAAKEIDLVEWKGDILTVGATEKDLARDGNS 99
>AMPL_SOLTU (P31427) Leucine aminopeptidase, chloroplast precursor (EC| 3.4.11.1) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) Length = 573 Score = 45.4 bits (106), Expect = 3e-05 Identities = 18/46 (39%), Positives = 30/46 (65%) Frame = +3 Query: 183 LGLTKANVVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDS 320 LGLT+ N + P+++ KD + W+GD+LA+ TE DL++ +S Sbjct: 59 LGLTRPNESDAPKISIGAKDTDVVQWQGDLLAIGATENDLARDDNS 104
>AMPL1_LYCES (Q10712) Leucine aminopeptidase 1, chloroplast precursor (EC| 3.4.11.1) (LAP 1) (Leucyl aminopeptidase 1) (Proline aminopeptidase 1) (EC 3.4.11.5) (Prolyl aminopeptidase 1) (DR57) Length = 571 Score = 43.5 bits (101), Expect = 1e-04 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +3 Query: 183 LGLTKANVVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDS 320 LGLT+ N + P+++ KD W+GD+LA+ TE D+++ +S Sbjct: 59 LGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENS 104
>UVRC_LACLA (Q9CH98) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 668 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 189 LTKANVVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLS 305 LTKA E+ FT K ++FSD K ++ +K+LS Sbjct: 330 LTKAQAKEVDAKVFTAKTLKFSDQKDVEQSIVKLDKELS 368
>PO2F1_HUMAN (P14859) POU domain, class 2, transcription factor 1| (Octamer-binding transcription factor 1) (Oct-1) (OTF-1) (NF-A1) Length = 743 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -1 Query: 274 RMSPFQSENSMSLPVKATWGSSTTLALVSPSAGTXXXXXXXXEVCPIL 131 R++P S + S P+KA + S T+L +PS T V P+L Sbjct: 436 RINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVT-SSAATTLTVSPVL 482
>ZMYM1_HUMAN (Q5SVZ6) Zinc finger MYM-type protein 1| Length = 1142 Score = 27.3 bits (59), Expect = 9.9 Identities = 19/42 (45%), Positives = 23/42 (54%) Frame = -1 Query: 304 DRSFSVTATARMSPFQSENSMSLPVKATWGSSTTLALVSPSA 179 D SVTATA + S++S S P A SST VSPS+ Sbjct: 368 DTVSSVTATADVIVDLSKSSPSEPSNAVASSSTEQPSVSPSS 409
>ZEP1_HUMAN (P15822) Zinc finger protein 40 (Human immunodeficiency virus type I| enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex-binding protein 1) (MBP-1) (Positive regulatory domain II-binding factor 1) (PRDII-BF1) Length = 2717 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 319 ESDPLDRSFSVTATARMSPFQSENSMSLPVKAT 221 E + + S S+T T R SP SEN+ P+K T Sbjct: 1856 EFENIKSSTSLTLTVRSSPAPSENTHLSPLKCT 1888 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,487,705 Number of Sequences: 219361 Number of extensions: 195957 Number of successful extensions: 672 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)