| Clone Name | bast40b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia p... | 30 | 2.0 | 2 | FMNL_HUMAN (O95466) Formin-like 1 protein (Formin-like protein) ... | 30 | 3.5 | 3 | SER1_GALME (O96614) Sericin-1 (Silk gum protein 1) (Fragment) | 28 | 7.7 |
|---|
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 17 LPPWEPELKAPPSATSRPSLARSELEPLGSV 109 LPP +P+L+ PPS P L ++ + +GS+ Sbjct: 753 LPPPQPQLQPPPSPQQMPPLEKARIAGVGSL 783
>FMNL_HUMAN (O95466) Formin-like 1 protein (Formin-like protein) (Leukocyte| formin) (CLL-associated antigen KW-13) Length = 1100 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +2 Query: 8 AARLPPWEPELKAPPSATSRPSLARSELEPL 100 A+R PP EPE KAPP+A +RPS ++E L Sbjct: 455 ASRRPP-EPE-KAPPAAPTRPSALELKVEEL 483
>SER1_GALME (O96614) Sericin-1 (Silk gum protein 1) (Fragment)| Length = 115 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -3 Query: 111 STDPSGSSSDLARDGREVADGGALSSGSHGGN 16 S+ SGSSS + +G + G + SSGS GG+ Sbjct: 77 SSGSSGSSSSSSSNGSGSSSGSSQSSGSQGGS 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,401,520 Number of Sequences: 219361 Number of extensions: 471731 Number of successful extensions: 2000 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1996 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)