| Clone Name | bast39f05 |
|---|---|
| Clone Library Name | barley_pub |
>STAD_SPIOL (P28645) Acyl-[acyl-carrier-protein] desaturase, chloroplast| precursor (EC 1.14.19.2) (Stearoyl-ACP desaturase) Length = 399 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 248 VPREQAEMVQSLNGWVAENMLPLLSP 325 +P+E+ E+ +SL GW EN+L L P Sbjct: 68 MPQEKIEIFKSLEGWAEENLLVHLKP 93
>GRPE2_PONPY (Q5R435) GrpE protein homolog 2, mitochondrial precursor| (Mt-GrpE#2) Length = 225 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 172 QTASRVCRTEHPPEARGPPRARVAL 98 +TA CR+E PP+ GPP A AL Sbjct: 38 RTAGEDCRSEDPPDELGPPLAERAL 62
>GRPE2_HUMAN (Q8TAA5) GrpE protein homolog 2, mitochondrial precursor| (Mt-GrpE#2) Length = 225 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 172 QTASRVCRTEHPPEARGPPRARVAL 98 +TA CR+E PP+ GPP A AL Sbjct: 38 RTAGEDCRSEDPPDELGPPLAERAL 62
>Y1699_PYRHO (O59362) UPF0095 protein PH1699| Length = 447 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 117 PEPASLLLEKKKQIFADVHAAGPVFAID 34 P+P +LLL++ K I A+VH + AI+ Sbjct: 368 PDPVALLLDENKNIIAEVHTRDLLNAIE 395
>UPL2_ARATH (Q8H0T4) E3 ubiquitin protein ligase UPL2 (EC 6.3.2.-)| (Ubiquitin-protein ligase 2) Length = 3658 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 227 IDVGFAPVPREQAEMVQSLNGWVAENMLPL 316 + +G PVPRE V++L V E +LP+ Sbjct: 1192 LSIGLFPVPREPETFVRNLQSQVLEVILPI 1221
>STAD_SIMCH (Q01753) Acyl-[acyl-carrier-protein] desaturase, chloroplast| precursor (EC 1.14.19.2) (Stearoyl-ACP desaturase) Length = 398 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 248 VPREQAEMVQSLNGWVAENMLPLLSP 325 +P ++ E+ +SL GW EN+L L P Sbjct: 67 MPPQKIEIFKSLEGWAEENVLVHLKP 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,990,616 Number of Sequences: 219361 Number of extensions: 509930 Number of successful extensions: 1651 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1650 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)