| Clone Name | bast36c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SIAL_RAT (P13839) Bone sialoprotein-2 precursor (Bone sialoprote... | 29 | 3.8 | 2 | YB4F_SCHPO (O14360) Hypothetical protein C30D10.15 in chromosome II | 28 | 8.6 |
|---|
>SIAL_RAT (P13839) Bone sialoprotein-2 precursor (Bone sialoprotein II) (BSP| II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Length = 320 Score = 29.3 bits (64), Expect = 3.8 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = +2 Query: 224 KLRDLLFAFHPAVHVYPSLVHVPRAGGDIDAREDGGEANEAEVWADSVKKKRKRKMNSTS 403 K R F + A + YP L P GG D+ E+ G+ + +E + + + + N S Sbjct: 38 KYRPRYFLYKHATYFYPPLKRFPVQGGS-DSSEENGDGDSSEEEGEEEETSNEEENNEDS 96
>YB4F_SCHPO (O14360) Hypothetical protein C30D10.15 in chromosome II| Length = 516 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 305 DIDAREDGGEANEAEVWADSVKKKRKRKMNS 397 +I+ E +EAEV A +KKKRKRK S Sbjct: 357 EINPSEQEFSDDEAEVAAKQLKKKRKRKAKS 387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.127 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,640,471 Number of Sequences: 219361 Number of extensions: 223153 Number of successful extensions: 712 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)