ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast36b02 |
|---|---|
| Clone Library Name | barley_pub |
>MMP24_HUMAN (Q9Y5R2) Matrix metalloproteinase-24 precursor (EC 3.4.24.-)| (MMP-24) (Membrane-type matrix metalloproteinase 5) (MT-MMP 5) (Membrane-type-5 matrix metalloproteinase) (MT5-MMP) Length = 645 Score = 29.6 bits (65), Expect = 1.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 236 PPPPGESRKWEDWELP 283 PPPPG++ +W W +P Sbjct: 17 PPPPGQAPRWSRWRVP 32
>BOR2_ARATH (Q9M1P7) Putative boron transporter 2| Length = 703 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/65 (27%), Positives = 27/65 (41%) Frame = +2 Query: 209 PKGYPMNRTPPPPGESRKWEDWELPCYVTSFLTVVILGVGLNAKPDLTLETWAHQKALER 388 PKG P P P +E+W + + V I+G + A L + H A + Sbjct: 259 PKGIPRRLFSPNPWSPGAYENWTVVKEMLQVPIVYIIGAFIPATMIAVLYYFDHSVASQL 318 Query: 389 LQQQE 403 QQ+E Sbjct: 319 AQQKE 323
>FTSZ_SHIFL (Q83MF6) Cell division protein ftsZ| Length = 383 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +2 Query: 302 LTVVILGVGLNAKPDLTLET--WAHQKALERLQQ 397 +TVV G+G++ +P++TL T Q ++R QQ Sbjct: 308 VTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQ 341
>FTSZ_ECOLI (P0A9A6) Cell division protein ftsZ| Length = 383 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +2 Query: 302 LTVVILGVGLNAKPDLTLET--WAHQKALERLQQ 397 +TVV G+G++ +P++TL T Q ++R QQ Sbjct: 308 VTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQ 341
>FTSZ_ECOL6 (P0A9A7) Cell division protein ftsZ| Length = 383 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +2 Query: 302 LTVVILGVGLNAKPDLTLET--WAHQKALERLQQ 397 +TVV G+G++ +P++TL T Q ++R QQ Sbjct: 308 VTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQ 341
>FTSZ_ECO57 (P0A9A8) Cell division protein ftsZ| Length = 383 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +2 Query: 302 LTVVILGVGLNAKPDLTLET--WAHQKALERLQQ 397 +TVV G+G++ +P++TL T Q ++R QQ Sbjct: 308 VTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQ 341
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 2 APKANRRPPSLSLRSPILHHAHAHQPGTMRAISS 103 AP+A++ PP LS SP +A+ P ++ +SS Sbjct: 932 APQAHKHPPHLSGPSPFSMNANLPPPPALKPLSS 965
>PS1C2_MOUSE (Q80ZC9) Psoriasis susceptibility 1 candidate gene 2 protein| homolog precursor (SPR1 protein) Length = 134 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 209 PKGYPMNRTPPPPGESRKWED 271 P P+ PPPPG +R W D Sbjct: 53 PGAPPLFDEPPPPGSNRPWRD 73
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 2 APKANRRPPSLSLRSPILHHAHAHQPGTMRAISS 103 AP+A++ PP LS SP +A+ P ++ +SS Sbjct: 941 APQAHKHPPHLSGPSPFSMNANLPPPPALKPLSS 974
>HCN3_RAT (Q9JKA8) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 3 Length = 780 Score = 27.7 bits (60), Expect = 6.8 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 10/64 (15%) Frame = -1 Query: 390 RRSSAFWCAQVSRVRSGLALS----------PTPRMTTVRKEVT*QGSSQSSHLRDSPGG 241 RRS+ + + VR+G L+ P P T+ ++ G SQ S L PGG Sbjct: 647 RRSAGSPASPLVPVRAGPLLARGPWASTSRLPAPPARTLHASLSRTGRSQVSLLGPPPGG 706 Query: 240 GGVR 229 GG R Sbjct: 707 GGRR 710
>YFRD_SCHPO (Q9UT43) Putative phospholipid-transporting ATPase C821.13c (EC| 3.6.3.1) Length = 1562 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 263 WEDWELPCYVTSFLTVVILGVGLNAKPDLTLET 361 +E W L C+ T F ++ ++G+G+ K DL+ T Sbjct: 1330 YESWGLTCFNTLFSSLCVIGLGIFEK-DLSAST 1361
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 2 APKANRRPPSLSLRSPILHHAHAHQPGTMRAISS 103 AP+A++ PP LS SP +A+ P ++ +SS Sbjct: 933 APQAHKHPPHLSGPSPFSLNANLPPPPALKPLSS 966
>IRAK1_HUMAN (P51617) Interleukin-1 receptor-associated kinase 1 (EC 2.7.11.1)| (IRAK-1) Length = 712 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 221 PMNRTPPPPGESRKWEDWELPCYVTSFLTVVILGVGLNAKPDLTL 355 P + P P E+ W +LP ++FL+ G ++ P+L L Sbjct: 116 PRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGL 160
>AKR1_GIBZE (Q4I8B6) Palmitoyltransferase AKR1 (EC 2.3.1.-) (Ankyrin| repeat-containing protein AKR1) Length = 702 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 26 PSLSLRSPILHHAHAHQPGTMRAIS 100 PSLS P H+H H+ G ++++S Sbjct: 582 PSLSATGPAAAHSHKHKGGMLKSLS 606 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.304 0.124 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,022,421 Number of Sequences: 219361 Number of extensions: 478853 Number of successful extensions: 1157 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)
