| Clone Name | bast36a09 |
|---|---|
| Clone Library Name | barley_pub |
>AMY1_ORYSA (P17654) Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) (Isozyme 1B) Length = 434 Score = 31.6 bits (70), Expect = 0.49 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 266 AGFLLEPPMDHLNSRPHRQLLGW 334 A F P +DHLN R R+L+GW Sbjct: 171 ADFAAAPDIDHLNKRVQRELIGW 193
>AM3E_ORYSA (P27934) Alpha-amylase isozyme 3E precursor (EC 3.2.1.1)| (1,4-alpha-D-glucan glucanohydrolase) Length = 437 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 251 HMHCLAGFLLEPPMDHLNSRPHRQLLGW 334 H AGF P +DHLN R R+L W Sbjct: 161 HRDTGAGFGAAPDIDHLNPRVQRELTDW 188
>RDRP_CGMVS (P69514) RNA-directed RNA polymerase (EC 2.7.7.48) (186 kDa protein)| [Contains: Methyltransferase/RNA helicase (MT/HEL) (129 kDa protein)] Length = 1648 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 296 DPLEAPVENQRGNACVPPSRDACSYPRI 213 DP+ A ++N+ N +P R AC PRI Sbjct: 1214 DPVPALIKNEAQNFLIPVLRTACERPRI 1241
>AMY3_WHEAT (P08117) Alpha-amylase AMY3 precursor (EC 3.2.1.1)| (1,4-alpha-D-glucan glucanohydrolase) Length = 413 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 251 HMHCLAGFLLEPPMDHLNSRPHRQLLGW 334 H GF P +DHLN R R+L W Sbjct: 160 HRDTGGGFDAAPDIDHLNPRVQRELSAW 187
>AROK_SYNEL (Q8DKH7) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 183 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 168 VAAATGGGLPARPLQDSRI*AGISTWWHTCIASL 269 + ATGGG+ P+ S + GI W H +A L Sbjct: 81 LVVATGGGIVLNPMNWSYLHHGIVVWLHVPLAVL 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,378,096 Number of Sequences: 219361 Number of extensions: 509411 Number of successful extensions: 1362 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1362 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)