ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast34f04 |
|---|---|
| Clone Library Name | barley_pub |
>IFRH_MAIZE (P52580) Isoflavone reductase homolog IRL (EC 1.3.1.-)| Length = 309 Score = 32.3 bits (72), Expect = 0.33 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +3 Query: 51 ERRRVLVVGGSGYLGQHXXXXXXXXXXXXXXXXXFTHHRGAAPRALLDAL--PGVRAFRA 224 E+ ++LVVGG+GYLG+H T A ALL + GV + Sbjct: 4 EKSKILVVGGTGYLGRHVVAASARLGHPTSALVRDTAPSDPAKAALLKSFQDAGVTLLKG 63 Query: 225 DL 230 DL Sbjct: 64 DL 65
>UXS1_RAT (Q5PQX0) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 31.2 bits (69), Expect = 0.74 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 42 SEMERRRVLVVGGSGYLGQH 101 SE +R+R+L+ GG+G++G H Sbjct: 84 SEKDRKRILITGGAGFVGSH 103
>UXS1_PONPY (Q5R885) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 31.2 bits (69), Expect = 0.74 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 42 SEMERRRVLVVGGSGYLGQH 101 SE +R+R+L+ GG+G++G H Sbjct: 84 SEKDRKRILITGGAGFVGSH 103
>UXS1_MOUSE (Q91XL3) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 31.2 bits (69), Expect = 0.74 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 42 SEMERRRVLVVGGSGYLGQH 101 SE +R+R+L+ GG+G++G H Sbjct: 84 SEKDRKRILITGGAGFVGSH 103
>UXS1_HUMAN (Q8NBZ7) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) Length = 420 Score = 31.2 bits (69), Expect = 0.74 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 42 SEMERRRVLVVGGSGYLGQH 101 SE +R+R+L+ GG+G++G H Sbjct: 84 SEKDRKRILITGGAGFVGSH 103
>UXS1_BRARE (Q6GMI9) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UXS-1) Length = 418 Score = 31.2 bits (69), Expect = 0.74 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 42 SEMERRRVLVVGGSGYLGQH 101 SE +R+R+L+ GG+G++G H Sbjct: 82 SEKDRKRILITGGAGFVGSH 101
>UXS1_XENTR (Q6DF08) UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35)| (UDP-glucuronate decarboxylase 1) (UXS-1) Length = 421 Score = 31.2 bits (69), Expect = 0.74 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 42 SEMERRRVLVVGGSGYLGQH 101 SE +R+R+L+ GG+G++G H Sbjct: 85 SEKDRKRILITGGAGFVGSH 104
>STCD_RHIME (O87278) Probable N-methylproline demethylase (EC 1.-.-.-)| (Stachydrine utilization protein stcD) Length = 678 Score = 30.4 bits (67), Expect = 1.3 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 242 VAGAEVGAKSTDPGERVEQRPRRRPAVVGEGHVDADAVAPGGQRGEEVL 96 + A G + T P + RR+ VVG G +A G+RG EV+ Sbjct: 364 IHNAATGRELTMPHSIAKAHCRRKVVVVGTGPAGLEAARVAGERGHEVI 412
>EXOB_RHIME (P26503) UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase)| Length = 328 Score = 29.3 bits (64), Expect = 2.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 48 MERRRVLVVGGSGYLGQH 101 M+ +LVVGG+GY+G H Sbjct: 1 MQNNNILVVGGAGYIGSH 18
>GALE_SALTY (P22715) UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase)| (UDP-galactose 4-epimerase) Length = 338 Score = 28.5 bits (62), Expect = 4.8 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 60 RVLVVGGSGYLGQH 101 RVLV GGSGY+G H Sbjct: 2 RVLVTGGSGYIGSH 15
>GALE_SALTI (Q56093) UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase)| (UDP-galactose 4-epimerase) Length = 338 Score = 28.5 bits (62), Expect = 4.8 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 60 RVLVVGGSGYLGQH 101 RVLV GGSGY+G H Sbjct: 2 RVLVTGGSGYIGSH 15
>GALE_ECOLI (P09147) UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase)| (UDP-galactose 4-epimerase) Length = 338 Score = 28.5 bits (62), Expect = 4.8 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 60 RVLVVGGSGYLGQH 101 RVLV GGSGY+G H Sbjct: 2 RVLVTGGSGYIGSH 15
>YBJT_ECOLI (P75822) Hypothetical protein ybjT| Length = 476 Score = 28.5 bits (62), Expect = 4.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 Query: 57 RRVLVVGGSGYLGQH 101 +R+LV+G SGY+GQH Sbjct: 3 QRILVLGASGYIGQH 17
>NSDHL_HUMAN (Q15738) Sterol-4-alpha-carboxylate 3-dehydrogenase,| decarboxylating (EC 1.1.1.170) (H105e3 protein) Length = 373 Score = 28.5 bits (62), Expect = 4.8 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 42 SEMERRRVLVVGGSGYLGQH 101 ++ + +R V+GGSG+LGQH Sbjct: 33 NQNQAKRCTVIGGSGFLGQH 52
>LAR_DESUN (Q84V83) Leucoanthocyanidin reductase (EC 1.17.1.3)| (Leucocyanidin reductase) Length = 382 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 21 LAVGSGRSEMERRRVLVVGGSGYLGQ 98 + V M + R LVVGG+G++GQ Sbjct: 1 MTVSGAIPSMTKNRTLVVGGTGFIGQ 26
>GAL10_YEAST (P04397) GAL10 bifunctional protein [Includes: UDP-glucose| 4-epimerase (EC 5.1.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)] Length = 699 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 39 RSEMERRRVLVVGGSGYLGQH 101 +SE + VLV GG+GY+G H Sbjct: 6 QSESTSKIVLVTGGAGYIGSH 26
>ARAE2_ARATH (O64749) Putative UDP-arabinose 4-epimerase 2 (EC 5.1.3.5)| (UDP-D-xylose 4-epimerase 2) Length = 417 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 39 RSEMERRRVLVVGGSGYLGQH 101 RSE VLV GG+GY+G H Sbjct: 64 RSEPGVTHVLVTGGAGYIGSH 84
>ARAE3_ARATH (Q9SUN3) Putative UDP-arabinose 4-epimerase 3 (EC 5.1.3.5)| (UDP-D-xylose 4-epimerase 3) Length = 411 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 39 RSEMERRRVLVVGGSGYLGQH 101 RSE VLV GG+GY+G H Sbjct: 64 RSEEGVTHVLVTGGAGYIGSH 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,259,942 Number of Sequences: 219361 Number of extensions: 220160 Number of successful extensions: 947 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 947 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
