| Clone Name | bast33h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1903_CORGL (Q6M4B7) Hypothetical RNA methyltransferase Cgl1903/... | 32 | 0.56 | 2 | NAS9_HORVU (Q9XFB7) Nicotianamine synthase 9 (EC 2.5.1.43) (S-ad... | 30 | 2.1 | 3 | RMRP_YEAST (P40993) RNase MRP protein component SNM1 | 28 | 8.2 |
|---|
>Y1903_CORGL (Q6M4B7) Hypothetical RNA methyltransferase Cgl1903/cg2084 (EC| 2.1.1.-) Length = 412 Score = 31.6 bits (70), Expect = 0.56 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 82 IGAKDGKVSHVRASAPASMCDLQIGARNHRWAAGE 186 IG DG+V V+ P + D++I +WA GE Sbjct: 27 IGHHDGRVIFVKGGIPGDVVDVEIAQLKKKWARGE 61
>NAS9_HORVU (Q9XFB7) Nicotianamine synthase 9 (EC 2.5.1.43)| (S-adenosyl-L-methionine:S-adenosyl-L-methionine:S- adenosyl-methionine 3-amino-3-carboxypropyltransferase 9) Length = 340 Score = 29.6 bits (65), Expect = 2.1 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -3 Query: 174 PSVIPSANLQVAHRSRSTS---PDMADLAIFGPNVQETRTRLIR 52 PS+ PS + TS P D+ GP+ QE R RLIR Sbjct: 33 PSLSPSPEVNALFTELVTSCIPPSTVDVDALGPDAQEMRARLIR 76
>RMRP_YEAST (P40993) RNase MRP protein component SNM1| Length = 198 Score = 27.7 bits (60), Expect = 8.2 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -3 Query: 249 DAPTTCVPRSCDGCGPRSKLPFASSPSVIPSANLQVAHRSRSTSPDMADLAIFGPNVQET 70 + P C+ +C C +SKL S V+P+ V+ STS A+ P +T Sbjct: 96 EGPKKCIQVNCLNC-EKSKLFEWKSEFVVPTFGQDVSPMINSTSSGKVSYAVKKPQKSKT 154 Query: 69 RT 64 T Sbjct: 155 ST 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,277,377 Number of Sequences: 219361 Number of extensions: 568723 Number of successful extensions: 1861 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1860 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)