| Clone Name | bast28g06 |
|---|---|
| Clone Library Name | barley_pub |
>LNK_MOUSE (O09039) Lymphocyte-specific adapter protein Lnk (Signal| transduction protein Lnk) (Lymphocyte adapter protein) Length = 548 Score = 35.0 bits (79), Expect = 0.095 Identities = 23/57 (40%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +2 Query: 224 AWLAEFKLLRLAAGQGPLHPSLPLPAFVAVASGPVRLRGDGPDKARQGTSSS--LDP 388 +WLAE LR + G G HP LP +A GP R D QG S LDP Sbjct: 269 SWLAE---LRASTGLGLEHPDTELPLSLAAEPGPARSPRGSTDSLDQGASPGVLLDP 322
>IAA16_ORYSA (P0C127) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 228 Score = 30.4 bits (67), Expect = 2.3 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 10/71 (14%) Frame = -1 Query: 342 SPRSLTGPEATATKAGSGRDGWRGP--------WPAAR--RRSLNSASQARKNPEMARGW 193 S L G +TA G DG++ WP R RR+L S+S + K P R Sbjct: 28 SSSGLQGNTSTAADGAKGNDGFKASRPAAPVVGWPPVRSFRRNLASSSSSSKPPRGGRDA 87 Query: 192 TARKAKGRNGR 160 A G+ R Sbjct: 88 AAAATGGKVAR 98
>FLHB_ECOLI (P76299) Flagellar biosynthetic protein flhB| Length = 382 Score = 29.6 bits (65), Expect = 4.0 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 221 LAWLAEFKLLRLAAGQGPLHPS-LPLP 298 LAW+ + K RLA GQ P+ P+ LP+P Sbjct: 343 LAWVWQLKRWRLAGGQRPVQPTHLPVP 369
>MAGI1_HUMAN (Q96QZ7) Membrane-associated guanylate kinase, WW and PDZ| domain-containing protein 1 (BAI1-associated protein 1) (BAP-1) (Membrane-associated guanylate kinase inverted 1) (MAGI-1) (Atrophin-1-interacting protein 3) (AIP3) (WW domain-containi Length = 1491 Score = 29.3 bits (64), Expect = 5.2 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 264 PAARRRSLNSASQARKNPEMARGWT-ARKAKGRNGRTA 154 P+ RRRSL + R++PE RG + R+AK + R A Sbjct: 1396 PSRRRRSLERLLEQRRSPERRRGGSPERRAKSTDRRRA 1433
>Y004_MYCSM (Q50434) UPF0232 protein in recF-gyrB intergenic region| Length = 194 Score = 29.3 bits (64), Expect = 5.2 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = -1 Query: 336 RSLTGPEATATKAGSGRDGWRGPWPAARRRSLNSASQARKNPEMARGWTARKAKG 172 R +GP A R W GP P AR L A ++ +RGW+AR A+G Sbjct: 52 RGRSGP-ARRVGGNRRRRTWSGPGPDARDPQLLGA--VTQDLAKSRGWSARVAEG 103
>CO9A1_CHICK (P12106) Collagen alpha-1(IX) chain precursor| Length = 920 Score = 28.9 bits (63), Expect = 6.8 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 366 PCRALSG-PSPRSLTGPEATATKAGSGRDGWRGP 268 P R + G P PR L G + GRDG RGP Sbjct: 844 PGRGVKGLPGPRGLPGEPGKPSYGREGRDGVRGP 877
>UNC5B_HUMAN (Q8IZJ1) Netrin receptor UNC5B precursor (Unc-5 homolog B) (Unc-5| homolog 2) (p53-regulated receptor for death and life protein 1) Length = 945 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 275 LHPSLP--LPAFVAVASGPVRLRGDGPDKARQGTSSSLDP 388 LHPS+P L A + GPV D DK S LDP Sbjct: 437 LHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDP 476
>MAGI1_MOUSE (Q6RHR9) Membrane-associated guanylate kinase, WW and PDZ| domain-containing protein 1 (BAI1-associated protein 1) (BAP-1) (Membrane-associated guanylate kinase inverted 1) (MAGI-1) Length = 1471 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 264 PAARRRSLNSASQARKNPEMARGWT-ARKAKGRNGRTA 154 P+ RRRSL R++PE RG + R+AK + R A Sbjct: 1376 PSRRRRSLERLLDQRRSPERRRGGSPERRAKSTDRRRA 1413
>HEMA_CDVA4 (Q66001) Hemagglutinin glycoprotein| Length = 607 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 272 PLHPSLPLPAFVAVASGPVRLRGDGPD 352 PL PS+ L ++ GPV L GDG D Sbjct: 412 PLDPSIDLQLNISFTYGPVILNGDGMD 438
>SOMA_SEBSC (P87391) Somatotropin precursor (Growth hormone)| Length = 204 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 372 DVPCRALSGPS-PRSLTGPEATATKAG 295 ++P R+LSG S PR+L P+ T KAG Sbjct: 103 EIPSRSLSGGSAPRNLISPKLTQLKAG 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.127 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,260,820 Number of Sequences: 219361 Number of extensions: 366942 Number of successful extensions: 1297 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1297 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)