| Clone Name | bast28c09 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_KUNJM (P14335) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3433 Score = 28.5 bits (62), Expect = 4.2 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 135 AWV*EASIGALLAWVGIGRRD 73 +W+ + +GALL W+GI RD Sbjct: 748 SWITQGLLGALLLWMGINARD 768
>POLG_WNV (P06935) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; F Length = 3430 Score = 28.5 bits (62), Expect = 4.2 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 135 AWV*EASIGALLAWVGIGRRD 73 +W+ + +GALL W+GI RD Sbjct: 744 SWITQGLLGALLLWMGINARD 764
>POLG_JAEVN (P14403) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 1440 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 135 AWV*EASIGALLAWVGIGRRD 73 +W+ + +GALL W+G+ RD Sbjct: 679 SWITQGLMGALLLWMGVNARD 699
>CNC_DROME (P20482) Segmentation protein cap'n'collar| Length = 1383 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 76 SPSNSNPSKQGTYTRLSNPSKASLKPPP 159 SPSN P G + + + + A+L+PPP Sbjct: 720 SPSNGAPGTPGQHGQYGSGANATLQPPP 747
>POLG_JAEVJ (P32886) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 135 AWV*EASIGALLAWVGIGRRD 73 +W+ + +GALL W+G+ RD Sbjct: 751 SWITQGLMGALLLWMGVNARD 771
>POLG_JAEV5 (P19110) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 135 AWV*EASIGALLAWVGIGRRD 73 +W+ + +GALL W+G+ RD Sbjct: 751 SWITQGLMGALLLWMGVNARD 771
>POLG_JAEV1 (P27395) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 135 AWV*EASIGALLAWVGIGRRD 73 +W+ + +GALL W+G+ RD Sbjct: 751 SWITQGLMGALLLWMGVNARD 771
>AP3D_ASHGO (Q755A1) AP-3 complex subunit delta (Adapter-related protein| complex 3 delta subunit) (Delta-adaptin 3) (AP-3 complex delta subunit) (Delta-adaptin) Length = 899 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 82 SNSNPSKQGTYTRLSNPSKASLK 150 SNS PS G+ RLS+ SKA K Sbjct: 743 SNSKPSSSGSLVRLSSESKAKEK 765
>NAS29_CAEEL (Q20958) Zinc metalloproteinase nas-29 precursor (EC 3.4.24.21)| (Nematode astacin 29) Length = 532 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 42 CINLILILVDCLSFQFQPKQARHLYSPLKP 131 C LIL+L C+S QF ++ L+ LKP Sbjct: 9 CGFLILVLATCMSAQFVSNESIKLHDILKP 38
>SYV_PARUW (Q6MAM1) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 949 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = -2 Query: 91 WNWKERQSTRI--RIRLMHDSKDWTGL 17 W WKE+ RI +++ + +S DWT L Sbjct: 118 WTWKEKSENRIIEQLKRLGNSCDWTRL 144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,401,405 Number of Sequences: 219361 Number of extensions: 475150 Number of successful extensions: 1562 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1561 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)