| Clone Name | bast27g09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYV_SCHPO (O75005) Probable valyl-tRNA synthetase, mitochondrial... | 29 | 3.1 | 2 | MTPC4_ARATH (Q8H1G3) Metal tolerance protein C4 (AtMTPc4) | 28 | 6.8 | 3 | MRAY_CHLAB (Q5L520) Phospho-N-acetylmuramoyl-pentapeptide-transf... | 28 | 8.9 | 4 | CCKN2_XENLA (P50145) Cholecystokinin type 2 precursor [Contains:... | 28 | 8.9 |
|---|
>SYV_SCHPO (O75005) Probable valyl-tRNA synthetase, mitochondrial precursor| (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 980 Score = 29.3 bits (64), Expect = 3.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 145 QEESRGRTCLWTTGRTSSTASLMSRSAFPPGSF 47 Q+ S GR W TGRT A +++AFP SF Sbjct: 538 QDRSEGR--YWVTGRTLEQAEEKAKAAFPGKSF 568
>MTPC4_ARATH (Q8H1G3) Metal tolerance protein C4 (AtMTPc4)| Length = 457 Score = 28.1 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 13 QSKLVSSIQSKRKIQEE-RPIGTSKKPCCWSGLSSIGMSCLCS 138 Q+ L + S R+ + P G SK+ WS +S++G+ CL S Sbjct: 157 QALLAYGLSSSRRAPDALHPYGYSKERFVWSLISAVGIFCLGS 199
>MRAY_CHLAB (Q5L520) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 347 Score = 27.7 bits (60), Expect = 8.9 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 86 FFDVPIG-LSSWIFLLLWIEETSLDW 12 FF +P+G LS+W+F L I +SL W Sbjct: 81 FFWLPLGKLSTWLFAFLIISWSSLGW 106
>CCKN2_XENLA (P50145) Cholecystokinin type 2 precursor [Contains:| Cholecystokinin (CCK)] Length = 128 Score = 27.7 bits (60), Expect = 8.9 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = -3 Query: 147 GKKRAEAGHAY------GRQAGPAARLL*CPDRPFLLDLSFALD*RDELG 16 G +R+ G+A R+AGP+ R + P+RP + D S ++ RD +G Sbjct: 64 GDQRSNIGNALVKYLQQSRKAGPSGRYVVLPNRP-IFDQSHRINDRDYMG 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,980,822 Number of Sequences: 219361 Number of extensions: 292665 Number of successful extensions: 887 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)