| Clone Name | bast27g02 |
|---|---|
| Clone Library Name | barley_pub |
>WRK26_ARATH (Q9C5T3) Probable WRKY transcription factor 26 (WRKY DNA-binding| protein 26) (SPF1-like protein) Length = 309 Score = 41.2 bits (95), Expect = 0.001 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 340 GMNLADFLDSPVLLTSS-IFPSPTTGAFGTQ 429 G+ ADFLDSP+L TSS I PSPTTG F Q Sbjct: 34 GLTPADFLDSPLLFTSSNILPSPTTGTFPAQ 64
>NUP62_RAT (P17955) Nuclear pore glycoprotein p62 (62 kDa nucleoporin)| Length = 525 Score = 31.2 bits (69), Expect = 1.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 73 SKTAVASRNAHARDFGSEPSPMTTSSSGSVETSANSRPGSFSFGSAS 213 S TA A+ FG S +T + SG+ +S + P F FGS++ Sbjct: 101 SSTAATPATANTGSFGLGSSTLTNAISGASTSSQGTAPTGFVFGSST 147
>WRK25_ARATH (O22921) Probable WRKY transcription factor 25 (WRKY DNA-binding| protein 25) Length = 393 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 352 ADFLDSPVLLTSS-IFPSPTTGAFGTQ 429 +D+LDSP+LL+SS SPTTG F Q Sbjct: 66 SDYLDSPLLLSSSHSLISPTTGTFPLQ 92
>POL_SIVMK (P05897) Pol polyprotein [Contains: Protease (Retropepsin) (EC| 3.4.23.-); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 1054 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -3 Query: 458 GAGASGRQLNCVPNAPVVGEGKILEVRSTGESRKSARFMPAG 333 G+ ASG NC P P G K L RK + G Sbjct: 58 GSSASGADANCSPRGPSCGSAKELHAVGQAAERKQREALQGG 99
>NU214_HUMAN (P35658) Nuclear pore complex protein Nup214 (Nucleoporin Nup214)| (214 kDa nucleoporin) (CAN protein) Length = 2090 Score = 28.9 bits (63), Expect = 6.8 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 115 FGSEPSPMTTSSSGSV--ETSANSRPGSFSFGSAS 213 FG S TS+SGSV S+ S SFSFG +S Sbjct: 1756 FGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSS 1790
>JHD1_USTMA (Q4P5U1) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 669 Score = 28.5 bits (62), Expect = 8.9 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 67 RTSKTAVASRNAHARDFGSEPSPMTTSSSGSVETSA 174 R S AS +AH R S P TTS S+ SA Sbjct: 9 RVSDPLAASSSAHPRTLRSSPRKRTTSHDSSISPSA 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.125 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,333,976 Number of Sequences: 219361 Number of extensions: 487580 Number of successful extensions: 1398 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1395 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)