| Clone Name | bast27c09 |
|---|---|
| Clone Library Name | barley_pub |
>MAVI_CUCPE (P80728) Mavicyanin| Length = 108 Score = 74.7 bits (182), Expect = 6e-14 Identities = 28/58 (48%), Positives = 44/58 (75%) Frame = +1 Query: 4 HNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRV 177 HNVL+V++ + SC +S+P A++TSG D + +K PG +F+CG+PGHC GQK+ ++V Sbjct: 44 HNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 101
>STEL_RHUVE (P00302) Stellacyanin| Length = 107 Score = 70.9 bits (172), Expect = 8e-13 Identities = 25/58 (43%), Positives = 45/58 (77%) Frame = +1 Query: 4 HNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRV 177 HNV +V + +Y SC ++TPIA++ +G++++ +K+ G +++ICGVP HC GQK+++ V Sbjct: 46 HNVDKVTQKNYQSCNDTTPIASYNTGBBRINLKTVGQKYYICGVPKHCDLGQKVHINV 103
>BCP_PEA (Q41001) Blue copper protein precursor| Length = 189 Score = 63.5 bits (153), Expect = 1e-10 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = +1 Query: 4 HNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRV 177 H V EV ++DY SCT+ I+T ++G + +K G +FICGVPGH G KL+++V Sbjct: 65 HTVDEVKESDYKSCTSGNSISTDSTGATTIPLKKAGKHYFICGVPGHSTGGMKLSIKV 122
>ENL1_ARATH (Q9SK27) Early nodulin-like protein 1 precursor (Phytocyanin-like| protein) Length = 176 Score = 60.1 bits (144), Expect = 1e-09 Identities = 27/58 (46%), Positives = 37/58 (63%) Frame = +1 Query: 7 NVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVL 180 +VLEV K YNSC + P+A +T G+ KV + G +FI G GHC GQKL++ V+ Sbjct: 69 SVLEVTKEAYNSCNTTNPLANYTDGETKVKLDRSGPFYFISGANGHCEKGQKLSLVVI 126
>BABL_LILLO (P60496) Chemocyanin precursor (Basic blue protein) (Plantacyanin)| Length = 126 Score = 57.4 bits (137), Expect = 9e-09 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = +1 Query: 1 IHNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNV 171 +HNV+ V Y SCT S SGDD++T+ S G +FIC VPGHC G K+ V Sbjct: 68 VHNVVSVPAGGYKSCTASPGSRVFKSGDDRITL-SRGTNYFICSVPGHCQGGLKIAV 123
>BABL_ARATH (Q8LG89) Putative basic blue protein precursor (Plantacyanin)| Length = 129 Score = 56.2 bits (134), Expect = 2e-08 Identities = 24/57 (42%), Positives = 35/57 (61%) Frame = +1 Query: 1 IHNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNV 171 +HNV++V+ YN+C T +TSG D++T+ S G FFIC P HC + K+ V Sbjct: 71 MHNVVKVDSGSYNNCKTPTGAKPYTSGKDRITL-SKGQNFFICNFPNHCESDMKIAV 126
>ENL2_ARATH (Q9T076) Early nodulin-like protein 2 precursor (Phytocyanin-like| protein) Length = 349 Score = 55.5 bits (132), Expect = 3e-08 Identities = 26/61 (42%), Positives = 37/61 (60%) Frame = +1 Query: 7 NVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVLKT 186 +VLEVNKADY++C PI GD ++++ G +FI G +C GQKLNV V+ Sbjct: 72 SVLEVNKADYDACNTKNPIKRVDDGDSEISLDRYGPFYFISGNEDNCKKGQKLNVVVISA 131 Query: 187 Q 189 + Sbjct: 132 R 132
>BCB2_ARATH (O80517) Uclacyanin-2 precursor (Uclacyanin-II) (Blue| copper-binding protein II) (BCB II) (Phytocyanin 2) Length = 202 Score = 55.1 bits (131), Expect = 5e-08 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +1 Query: 4 HNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCA--AGQKLNVRV 177 H V V+KA Y+ C S+ H+ GD K+ +K+ G +FIC PGHC G KL V V Sbjct: 65 HTVDVVDKAGYDGCDASSSTENHSDGDTKIDLKTVGINYFICSTPGHCRTNGGMKLAVNV 124 Query: 178 L 180 + Sbjct: 125 V 125
>BABL_CUCSA (P00303) Basic blue protein (Cusacyanin) (Plantacyanin) (CBP)| Length = 96 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/60 (36%), Positives = 35/60 (58%) Frame = +1 Query: 1 IHNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVL 180 +HNV+ VN+ +++C +TSG D++ + G +FIC PGHC +G K+ V L Sbjct: 38 MHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPK-GQSYFICNFPGHCQSGMKIAVNAL 96
>ENL3_ARATH (Q8LC95) Early nodulin-like protein 3 precursor (Phytocyanin-like| protein) Length = 186 Score = 50.8 bits (120), Expect = 9e-07 Identities = 22/61 (36%), Positives = 38/61 (62%) Frame = +1 Query: 7 NVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVLKT 186 +VL+V K Y +C + P A +++GD KV ++ G FFI G +C G+KL++ V+ + Sbjct: 70 SVLQVTKDAYINCNTTNPAANYSNGDTKVKLERSGPYFFISGSKSNCVEGEKLHIVVMSS 129 Query: 187 Q 189 + Sbjct: 130 R 130
>UMEC_ARMRU (P42849) Umecyanin (UMC)| Length = 115 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/60 (33%), Positives = 36/60 (60%) Frame = +1 Query: 1 IHNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVL 180 +H+V V K +++C PI+ T+ K+ + + G +++IC V HC GQKL++ V+ Sbjct: 43 MHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVV 102
>BCB1_ARATH (Q07488) Blue copper protein precursor (Blue copper-binding| protein) (AtBCB) (Stellacyanin) (Phytocyanin 1) Length = 196 Score = 47.4 bits (111), Expect = 9e-06 Identities = 21/59 (35%), Positives = 35/59 (59%) Frame = +1 Query: 4 HNVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVL 180 H+V V++A + +C PI+ T K+ + + G ++FIC V HC GQKL++ V+ Sbjct: 66 HDVAVVSEAAFENCEKEKPISHMTVPPVKIMLNTTGPQYFICTVGDHCRFGQKLSITVV 124
>NO552_SOYBN (Q02917) Early nodulin 55-2 precursor (N-55-2) (Nodulin-315)| Length = 187 Score = 41.6 bits (96), Expect = 5e-04 Identities = 24/63 (38%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 7 NVLEVNKADYNSC-TNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVLK 183 +V E N+ DY C T G+ KV + PG R FI G HC G KL V V+ Sbjct: 73 SVHEGNETDYEGCNTVGKYHIVFNGGNTKVMLTKPGFRHFISGNQSHCQMGLKLAVLVIS 132 Query: 184 TQK 192 + K Sbjct: 133 SNK 135
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 37.7 bits (86), Expect = 0.007 Identities = 21/58 (36%), Positives = 27/58 (46%) Frame = +1 Query: 7 NVLEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFICGVPGHCAAGQKLNVRVL 180 +V EV + DY+ C H G+ V +K G FI G HC G KL V V+ Sbjct: 71 SVHEVEEEDYDRCGIRGEHVDHYDGNTMVVLKKTGIHHFISGKKRHCRLGLKLAVVVM 128
>CPC_CUCSA (P29602) Cucumber peeling cupredoxin (CPC) (Stellacyanin)| Length = 137 Score = 33.1 bits (74), Expect = 0.18 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 9/68 (13%) Frame = +1 Query: 4 HNVLEVN-KADYNSCTNSTPIATHTSGDDKVTIKSP--------GHRFFICGVPGHCAAG 156 HNV E+ K +++C + D+ V SP G +F+C V HC+ G Sbjct: 46 HNVHEMETKQSFDACN-------FVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNG 98 Query: 157 QKLNVRVL 180 QKL++ V+ Sbjct: 99 QKLSINVV 106
>SYFB_PSEPK (Q88K22) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 793 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 13 LEVNKADYNSCTNSTPIATHTSGDDKVTIKSPGHRFFI 126 +E++ A N+ + T SG+ + T+ P HRF I Sbjct: 419 MEMDPAQVEQLLNALELTTTKSGEGQWTVSVPSHRFDI 456 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.129 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,127,173 Number of Sequences: 219361 Number of extensions: 369488 Number of successful extensions: 1045 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)