ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast27c03 |
|---|---|
| Clone Library Name | barley_pub |
>PER62_ARATH (Q9FKA4) Peroxidase 62 precursor (EC 1.11.1.7) (Atperox P62)| (ATP24a) Length = 319 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +2 Query: 224 RVGFYNTTCPNAEAI 268 R+GFY+TTCPNAE I Sbjct: 26 RIGFYSTTCPNAETI 40
>PER13_ARATH (O49293) Peroxidase 13 precursor (EC 1.11.1.7) (Atperox P13)| Length = 319 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 206 HSRAQLRVGFYNTTCPNAEAI 268 +S AQL+ GFY+ TCP+AE+I Sbjct: 19 YSAAQLQFGFYSETCPSAESI 39
>PER57_ARATH (Q43729) Peroxidase 57 precursor (EC 1.11.1.7) (Atperox P57)| (PRXR10) (ATP13a) Length = 313 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 215 AQLRVGFYNTTCPNAEAI 268 AQLRVGFY+ +CP AE I Sbjct: 22 AQLRVGFYSQSCPQAETI 39
>PER39_ARATH (Q9SUT2) Peroxidase 39 precursor (EC 1.11.1.7) (Atperox P39)| (ATP19a) Length = 326 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 209 SRAQLRVGFYNTTCPNAEAI 268 S AQL++GFY+ TCP AE I Sbjct: 21 SEAQLKMGFYDQTCPYAEKI 40
>PER45_ARATH (Q96522) Peroxidase 45 precursor (EC 1.11.1.7) (Atperox P45)| (ATP8a) Length = 325 Score = 31.2 bits (69), Expect = 0.72 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 215 AQLRVGFYNTTCPNAEAI 268 AQLR GFY +CPN E I Sbjct: 25 AQLRTGFYQNSCPNVETI 42
>PER43_ARATH (Q9SZH2) Peroxidase 43 precursor (EC 1.11.1.7) (Atperox P43)| Length = 326 Score = 31.2 bits (69), Expect = 0.72 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 209 SRAQLRVGFYNTTCPNAEAI 268 S A L VGFY+ TCP AE+I Sbjct: 22 SLANLEVGFYSNTCPQAESI 41
>PER44_ARATH (Q93V93) Peroxidase 44 precursor (EC 1.11.1.7) (Atperox P44)| (ATP35) Length = 310 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 215 AQLRVGFYNTTCPNAEAI 268 AQLR GFY+ +CP AE+I Sbjct: 20 AQLRTGFYSRSCPRAESI 37
>PER58_ARATH (P59120) Peroxidase 58 precursor (EC 1.11.1.7) (Atperox P58)| (ATP42) Length = 329 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 203 VHSRAQLRVGFYNTTCPNAEAI 268 V S AQL FY+TTCPN AI Sbjct: 19 VLSNAQLTSDFYSTTCPNVTAI 40
>PER54_ARATH (Q9FG34) Peroxidase 54 precursor (EC 1.11.1.7) (Atperox P54)| (ATP29a) Length = 358 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 Query: 209 SRAQLRVGFYNTTCPNAEAI 268 S AQL FY+ TCPNA AI Sbjct: 29 SSAQLNATFYSGTCPNASAI 48
>PER8_ARATH (Q9LNL0) Peroxidase 8 precursor (EC 1.11.1.7) (Atperox P8)| Length = 310 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 215 AQLRVGFYNTTCPNAEAI 268 AQLR GFY TCP AE+I Sbjct: 20 AQLRHGFYEGTCPPAESI 37
>PER35_ARATH (Q96510) Peroxidase 35 precursor (EC 1.11.1.7) (Atperox P35)| (ATP21a) Length = 329 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 200 PVHSRAQLRVGFYNTTCPNAEAI 268 P + AQL GFY+ TCPN E I Sbjct: 20 PDTTTAQLSRGFYSKTCPNVEQI 42
>PER53_ARATH (Q42578) Peroxidase 53 precursor (EC 1.11.1.7) (Atperox P53)| (ATPA2) Length = 335 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 Query: 209 SRAQLRVGFYNTTCPNAEAI 268 S AQL FY+ TCPNA AI Sbjct: 28 SSAQLNATFYSGTCPNASAI 47
>PERX_TOBAC (P11965) Lignin forming anionic peroxidase precursor (EC 1.11.1.7)| (TOPA) Length = 324 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 209 SRAQLRVGFYNTTCPNAEAI 268 S AQL FY+TTCPN +I Sbjct: 20 SNAQLSATFYDTTCPNVTSI 39
>PER30_ARATH (Q9LSY7) Peroxidase 30 precursor (EC 1.11.1.7) (Atperox P30)| (PRXR9) (ATP7a) Length = 329 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 209 SRAQLRVGFYNTTCPNAEAI 268 S AQL++ FY +CPNAE I Sbjct: 25 SEAQLQMNFYAKSCPNAEKI 44
>PER2_ARAHY (P22196) Cationic peroxidase 2 precursor (EC 1.11.1.7) (PNPC2)| Length = 330 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 224 RVGFYNTTCPNAEAI 268 RVGFY+ TCP AE+I Sbjct: 33 RVGFYSRTCPRAESI 47
>PER71_ARATH (Q43387) Peroxidase 71 precursor (EC 1.11.1.7) (Atperox P71)| (ATP15a) (ATPO2) Length = 328 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 224 RVGFYNTTCPNAEAI 268 R+GFY TTCP AE I Sbjct: 36 RIGFYLTTCPRAETI 50
>INHA_RAT (P17490) Inhibin alpha chain precursor| Length = 366 Score = 28.5 bits (62), Expect = 4.7 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = -1 Query: 216 ARLW--TGSCRHSTAVSSTARPARLPLLAMVASLA*LKYLSPSQGRHSERQLHSSNGCYP 43 A+LW TG R STA S+++RP L LL + + +S Q LH + +P Sbjct: 130 AQLWFHTGLDRKSTAASNSSRPL-LDLLVLSSGGPMAVPVSLGQSPPRWAVLHLAASAFP 188 Query: 42 MLMYP 28 +L +P Sbjct: 189 LLTHP 193
>PER3_ARATH (O23044) Peroxidase 3 precursor (EC 1.11.1.7) (Atperox P3) (Rare| cold-inducible protein) (RCI3A) (ATPRC) Length = 326 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 212 RAQLRVGFYNTTCPNAEAI 268 +AQL++ FY +CPNAE I Sbjct: 23 QAQLQMNFYANSCPNAEKI 41
>PER73_ARATH (Q43873) Peroxidase 73 precursor (EC 1.11.1.7) (Atperox P73)| (PRXR11) (ATP10a) Length = 329 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 200 PVHSRAQLRVGFYNTTCPNAEAI 268 P + AQL+ FY +CPN E I Sbjct: 20 PDTTTAQLKTNFYGNSCPNVEQI 42
>PER51_ARATH (Q9SZE7) Peroxidase 51 precursor (EC 1.11.1.7) (Atperox P51)| (ATP37) Length = 329 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 209 SRAQLRVGFYNTTCPNAEAI 268 S AQLR FY TCPN E I Sbjct: 23 SSAQLRGDFYAGTCPNVEQI 42
>PER28_ARATH (Q9SS67) Peroxidase 28 precursor (EC 1.11.1.7) (Atperox P28)| (ATP39) Length = 321 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 215 AQLRVGFYNTTCPNAEAI 268 AQL+ FY+ +CPNAE I Sbjct: 21 AQLKFKFYSESCPNAETI 38 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,879,492 Number of Sequences: 219361 Number of extensions: 399848 Number of successful extensions: 1190 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1190 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
