| Clone Name | bast27b05 |
|---|---|
| Clone Library Name | barley_pub |
>PRP5_USTMA (Q4PFD9) Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (EC| 3.6.1.-) Length = 1156 Score = 30.8 bits (68), Expect = 1.6 Identities = 25/60 (41%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = +1 Query: 82 RNHRSVISLLPST*---IHAENCPRQLFRRIWFPFLPWHPLLAG*VHLS--FYSSLDTIL 246 R+H S I PS H E PRQ RR W P P A VH+S SSL+T L Sbjct: 87 RDHDSPIEAAPSPDGRRFHVEGAPRQGGRRRWDEGAPTPPTAAAPVHVSDPTRSSLNTQL 146
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 30.8 bits (68), Expect = 1.6 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 215 RCTHPARSGCQGRKGNQIRRKSCRGQFSAWIHVEGNKLITDLW 87 RC P SGC+GR G+ C G W + + + D W Sbjct: 1165 RCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCSLGVPDPW 1207
>GSA_CHLRE (Q39566) Glutamate-1-semialdehyde 2,1-aminomutase, chloroplast| precursor (EC 5.4.3.8) (GSA) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) Length = 463 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 119 RESTRKIARGNFSGGFGFPFCLGIHSLLGECTSAST 226 +E + +I GN SG FGF FC G + + +A T Sbjct: 378 KEHSHEITGGNISGMFGFFFCKGPVTCFEDALAADT 413
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -1 Query: 215 RCTHPARSGCQGRKGNQIRRKSCRGQFSAWIHVEGNKLITDLW 87 RC P GC+GR G+ C G W + + + D W Sbjct: 1169 RCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPW 1211
>CDC5_YEAST (P32562) Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC| 2.7.11.21) Length = 705 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 143 RGNFSGGFGFPFCLGIHSLLGECTSASTLV*IQYYSTKTRRSIQDAI 283 RG+F G GF C I GE +A T+ S KTR+ + I Sbjct: 84 RGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEI 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,154,595 Number of Sequences: 219361 Number of extensions: 921736 Number of successful extensions: 2556 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2556 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)