| Clone Name | bast26f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HDA2_ASHGO (Q75EZ7) HDA1 complex subunit 2 (Histone deacetylase ... | 29 | 4.6 | 2 | CLC3A_HUMAN (O75596) C-type lectin domain family 3 member A prec... | 29 | 6.0 | 3 | RT31_HUMAN (Q92665) 28S ribosomal protein S31, mitochondrial pre... | 28 | 7.9 |
|---|
>HDA2_ASHGO (Q75EZ7) HDA1 complex subunit 2 (Histone deacetylase complex 1| subunit 2) Length = 665 Score = 29.3 bits (64), Expect = 4.6 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 287 EHGEQLRRRQHSLSELTYSRDDDAKLETTRARL 385 E LRRR+ L EL S D D+++ + RARL Sbjct: 499 EKSAHLRRRKAELEELLASSDLDSRVSSKRARL 531
>CLC3A_HUMAN (O75596) C-type lectin domain family 3 member A precursor (C-type| lectin superfamily member 1) (Cartilage-derived C-type lectin) Length = 197 Score = 28.9 bits (63), Expect = 6.0 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 254 LSVTLALSSPTEHGEQLRRRQHSLSELTYSRDDDAKLETTRARLLGVLKGMK 409 L +TL L T H +L+ R+HS + RD D L+T +L + +K Sbjct: 11 LVITLLLDQTTSHTSRLKARKHSKRRV---RDKDGDLKTQIEKLWTEVNALK 59
>RT31_HUMAN (Q92665) 28S ribosomal protein S31, mitochondrial precursor (S31mt)| (MRP-S31) (Imogen 38) Length = 395 Score = 28.5 bits (62), Expect = 7.9 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 341 SRDDDAKLETTRARLLGVLKGMKI 412 S D++ E T+ LLG++KGMK+ Sbjct: 85 SESQDSEKENTKKDLLGIIKGMKV 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,185,921 Number of Sequences: 219361 Number of extensions: 552003 Number of successful extensions: 2107 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2107 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)