| Clone Name | bast26d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PIGQ_MOUSE (Q9QYT7) Phosphatidylinositol N-acetylglucosaminyltra... | 30 | 2.2 | 2 | CAC1H_HUMAN (O95180) Voltage-dependent T-type calcium channel al... | 29 | 4.9 | 3 | CRLS1_HUMAN (Q9UJA2) Cardiolipin synthetase (EC 2.7.8.-) (Cardio... | 28 | 8.3 |
|---|
>PIGQ_MOUSE (Q9QYT7) Phosphatidylinositol N-acetylglucosaminyltransferase| subunit Q (EC 2.4.1.198) (Phosphatidylinositol-glycan biosynthesis, class Q protein) (PIG-Q) (N-acetylglucosamyl transferase component GPI1) (MGpi1p) Length = 580 Score = 30.0 bits (66), Expect = 2.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 135 PPCCAGARPGSLVGQWRPRQ 194 P CCA A G LVG+W P Q Sbjct: 7 PTCCASADSGLLVGRWVPGQ 26
>CAC1H_HUMAN (O95180) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) (Low-voltage-activated calcium channel alpha1 3.2 subunit) Length = 2353 Score = 28.9 bits (63), Expect = 4.9 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = -1 Query: 101 PCRAKAWEPDER-----RKKKKMRQDCFSSSPGTPD 9 P AKAW P+ R+KKKM C S P D Sbjct: 2165 PGEAKAWGPEAEPALGARRKKKMSPPCISVEPPAED 2200
>CRLS1_HUMAN (Q9UJA2) Cardiolipin synthetase (EC 2.7.8.-) (Cardiolipin synthase)| (CLS) (Protein GCD10 homolog) Length = 301 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 72 IRFPRFGTARHRRGTACSDARPPCCAGARPGSLVGQWRP 188 +R P G H G + RP AGA + GQW P Sbjct: 58 LRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGP 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,613,861 Number of Sequences: 219361 Number of extensions: 464917 Number of successful extensions: 1560 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1559 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)