| Clone Name | bast25d07 |
|---|---|
| Clone Library Name | barley_pub |
>CRTI_MYXXA (Q02861) Phytoene dehydrogenase (EC 1.14.99.-) (Phytoene| desaturase) Length = 529 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -1 Query: 278 DEAGVPKARCLVHVLVEPPAAGRQVELADEQHELRVQAP 162 D +G P ++VLV P GR V+ + LR + P Sbjct: 373 DPSGAPAGHSTLYVLVPTPNTGRPVDWVKTEQALRERIP 411
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/39 (25%), Positives = 16/39 (41%) Frame = -2 Query: 280 TTRQASQRRAVSSMYSSSHRPPGGRWSWPTSSMSCECRP 164 + Q + + Y++ H PG W P + C C P Sbjct: 1210 SNNQCINESSCNCPYNNKHYKPGEEWFTPNCTERCRCLP 1248
>FUT4_PANTR (Q659K9) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) Length = 405 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 253 AVSSMYSSSHRPPGGRWSW 197 A ++ +SS RPPG RW W Sbjct: 151 AAEALATSSPRPPGQRWVW 169
>FUT4_HUMAN (P22083) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) (ELAM-1 ligand fucosyltransferase) Length = 405 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 253 AVSSMYSSSHRPPGGRWSW 197 A ++ +SS RPPG RW W Sbjct: 151 AAEALATSSPRPPGQRWVW 169
>TRF_DROME (Q27896) TBP-related factor| Length = 224 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 293 EAELDDEAGVPKARCLVHVLVEPPAAGRQVELADEQHELRVQ 168 E + D+ A A H ++P VE D QHE+R+Q Sbjct: 11 ERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIRLQ 52
>OAT5_HUMAN (Q63ZE4) Solute carrier family 22 member 10 (Organic anion| transporter 5) Length = 531 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 272 AGVPKARCLVHVLVEPPAAGRQVELADEQHELRVQAP 162 A +P RC VH+L +G + + E LR+ P Sbjct: 42 AAIPGHRCWVHMLDNNTGSGNETGILSEDALLRISIP 78
>FURIN_MOUSE (P23188) Furin precursor (EC 3.4.21.75) (Paired basic amino acid| residue cleaving enzyme) (PACE) (Dibasic-processing enzyme) (Prohormone convertase 3) Length = 793 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -1 Query: 263 PKARCLVHVLVEPPAAGRQVEL 198 P+ +C+V +LVEP G+++E+ Sbjct: 446 PQRKCIVEILVEPKDIGKRLEV 467 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,051,490 Number of Sequences: 219361 Number of extensions: 333811 Number of successful extensions: 1590 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1590 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)