| Clone Name | bast22b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EPL1_SCHPO (Q9UU94) Enhancer of polycomb-like protein 1 | 28 | 6.6 | 2 | ACHA3_CHICK (P09481) Neuronal acetylcholine receptor protein, al... | 28 | 8.6 |
|---|
>EPL1_SCHPO (Q9UU94) Enhancer of polycomb-like protein 1| Length = 557 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 5 NHNPFEVTSSRPDYGLVSSDSLMTSSPHSSLENVNLLTS 121 +HN + SS P L S + S+PHSSL N N S Sbjct: 425 SHNQLSIPSSTPSTPL-SDNGPTYSTPHSSLSNFNTCDS 462
>ACHA3_CHICK (P09481) Neuronal acetylcholine receptor protein, alpha-3 subunit| precursor Length = 496 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 171 KCCRESELCCSFESARCEVSRLTFSKEL*GELVISESDET 52 KCC++ +C + C+ R+ FS + G L S S E+ Sbjct: 380 KCCKDGFVCQDMACSCCQYQRMKFS-DFSGNLTRSSSSES 418 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.131 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,814,931 Number of Sequences: 219361 Number of extensions: 219397 Number of successful extensions: 533 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)