| Clone Name | bast21h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SAT_RIFPS (Q54506) Sulfate adenylyltransferase (EC 2.7.7.4) (Sul... | 29 | 3.1 | 2 | T2MW_METWO (O59646) Type II restriction enzyme MwoI (EC 3.1.21.4... | 29 | 3.1 |
|---|
>SAT_RIFPS (Q54506) Sulfate adenylyltransferase (EC 2.7.7.4) (Sulfate| adenylate transferase) (SAT) (ATP-sulfurylase) Length = 437 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 128 PTEAKTTVPVGSRPGSMIGVMACGWQSRALCK 33 P TTVP RP SM W+SR+ C+ Sbjct: 297 PAWVTTTVPSTPRPSSMTKCQRAPWRSRSSCR 328
>T2MW_METWO (O59646) Type II restriction enzyme MwoI (EC 3.1.21.4)| (Endonuclease MwoI) (R.MwoI) Length = 363 Score = 29.3 bits (64), Expect = 3.1 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -2 Query: 137 LVTPTEAKTTVPVGSRPGSMIGVMACGWQSRALCKGDCRLYLVGP 3 L P++ K TVP+G S GV+ C + + + K DC+ V P Sbjct: 116 LENPSDFKDTVPLGINQSSYPGVLDCKIRGKNI-KADCKKIKVYP 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,511,943 Number of Sequences: 219361 Number of extensions: 196854 Number of successful extensions: 729 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 80,573,946 effective HSP length: 25 effective length of database: 75,089,921 effective search space used: 1802158104 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)