ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast18g01 |
|---|---|
| Clone Library Name | barley_pub |
>FTSH_MEDSA (Q9BAE0) Cell division protein ftsH homolog, chloroplast precursor| (EC 3.4.24.-) Length = 706 Score = 66.2 bits (160), Expect(2) = 1e-12 Identities = 32/51 (62%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = +2 Query: 239 AANPFADTL-LTTPKP-GSAAADIPDGGQWRYSEFLAAVKKGKVERVRFSR 385 + +PF+ + LT PKP ++ D+PDG QWRYSEFL AVKKGKVERVRFS+ Sbjct: 98 STSPFSQNISLTAPKPQAQSSTDLPDGSQWRYSEFLNAVKKGKVERVRFSK 148 Score = 24.6 bits (52), Expect(2) = 1e-12 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 382 QDGGMLQLTAVDG 420 +DG +LQLTAVDG Sbjct: 148 KDGSVLQLTAVDG 160
>FTSH2_ARATH (Q9FH02) Cell division protein ftsH homolog 2, chloroplast| precursor (EC 3.4.24.-) Length = 704 Score = 65.1 bits (157), Expect(2) = 1e-11 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +2 Query: 257 DTLLTTPKPGSAAADIPDGGQWRYSEFLAAVKKGKVERVRFSR 385 + L+T P P + ++D+PDG QWRYSEFL AVKKGKVERV+FS+ Sbjct: 103 NVLMTAPNPQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSK 145 Score = 22.3 bits (46), Expect(2) = 1e-11 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 382 QDGGMLQLTAVD 417 +DG +LQLTAVD Sbjct: 145 KDGSVLQLTAVD 156
>FTSH_TOBAC (O82150) Cell division protein ftsH homolog, chloroplast precursor| (EC 3.4.24.-) (DS9) Length = 714 Score = 57.8 bits (138), Expect(2) = 6e-10 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +2 Query: 242 ANPFADTL-LTTPKPGSAA-ADIPDGGQWRYSEFLAAVKKGKVERVRFSR 385 +NPF+ + L PKP + ++P+ QWRYSEFL AVKKGKVERVRFS+ Sbjct: 99 SNPFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSK 148 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 382 QDGGMLQLTAVDG 420 +DG LQLTAVDG Sbjct: 148 KDGSALQLTAVDG 160
>FTSH_CAPAN (Q39444) Cell division protein ftsH homolog, chloroplast precursor| (EC 3.4.24.-) (Fragment) Length = 662 Score = 57.4 bits (137), Expect(2) = 8e-10 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = +2 Query: 248 PFADTL-LTTPKP-GSAAADIPDGGQWRYSEFLAAVKKGKVERVRFSR 385 PF+ L L PK S +D+P+ QWRYSEFL AVKKGKVERVRFS+ Sbjct: 78 PFSQNLVLNAPKTQASPVSDLPESTQWRYSEFLNAVKKGKVERVRFSK 125 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 382 QDGGMLQLTAVDG 420 +DG LQLTAVDG Sbjct: 125 KDGSALQLTAVDG 137
>FTSH1_ARATH (Q39102) Cell division protein ftsH homolog 1, chloroplast| precursor (EC 3.4.24.-) Length = 716 Score = 60.5 bits (145), Expect = 2e-09 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +2 Query: 233 TPAANPFADTLLTTPKPGSAAADIPDGGQWRYSEFLAAVKKGKVERVRFSR 385 TP+ + +L P P S+ D+P+G QWRYSEFL AVKKGKVERVRFS+ Sbjct: 107 TPSPLFIQNEILKAPSPKSS--DLPEGSQWRYSEFLNAVKKGKVERVRFSK 155
>LIPA_MYCPA (P61197) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 307 Score = 31.6 bits (70), Expect = 0.80 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 284 GSAAADIPDGGQWRYSEFLAAVKK 355 G A D+PDGG W Y+E + A+K+ Sbjct: 122 GVARDDLPDGGAWLYAETVRAIKE 145
>LIPA_MYCLE (O32962) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 314 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 272 TPKPGSAAADIPDGGQWRYSEFLAAVKK 355 T G A D+PDGG W Y+ + A+K+ Sbjct: 118 TTVTGVARDDLPDGGAWLYATTVRAIKE 145
>LIPA_MYCTU (P65283) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 311 Score = 29.3 bits (64), Expect = 3.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 284 GSAAADIPDGGQWRYSEFLAAVKK 355 G A D+PDGG W Y+ + A+K+ Sbjct: 122 GVARDDLPDGGAWLYAATVRAIKE 145
>LIPA_MYCBO (P65284) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 311 Score = 29.3 bits (64), Expect = 3.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 284 GSAAADIPDGGQWRYSEFLAAVKK 355 G A D+PDGG W Y+ + A+K+ Sbjct: 122 GVARDDLPDGGAWLYAATVRAIKE 145
>LIPA_TROWT (Q83MU9) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 351 Score = 28.9 bits (63), Expect = 5.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 284 GSAAADIPDGGQWRYSEFLAAVKK 355 G A D+PDGG W Y+E + + K Sbjct: 141 GVARDDLPDGGVWLYAETIREIHK 164
>LIPA_TROW8 (Q83NN8) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 351 Score = 28.9 bits (63), Expect = 5.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 284 GSAAADIPDGGQWRYSEFLAAVKK 355 G A D+PDGG W Y+E + + K Sbjct: 141 GVARDDLPDGGVWLYAETIREIHK 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,874,756 Number of Sequences: 219361 Number of extensions: 247097 Number of successful extensions: 518 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits)
