| Clone Name | bast14c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ECM27_YEAST (P47144) Extracellular matrix protein 27 | 29 | 2.7 | 2 | XRN1_MOUSE (P97789) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (mXRN1... | 29 | 2.7 | 3 | CEF1_ASHGO (Q756C3) Pre-mRNA-splicing factor CEF1 | 28 | 7.9 | 4 | CCA_PYRKO (Q5JJ38) CCA-adding enzyme (EC 2.7.7.25) (EC 2.7.7.21)... | 28 | 7.9 |
|---|
>ECM27_YEAST (P47144) Extracellular matrix protein 27| Length = 725 Score = 29.3 bits (64), Expect = 2.7 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +2 Query: 125 FIHLLLPPSLHCSISSSCPTKHLDRLAAAFPLVL 226 FI + P L CSI S T HL L FPL+L Sbjct: 445 FIQSITAPFLLCSILSVLLTYHLGYLVYLFPLIL 478
>XRN1_MOUSE (P97789) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (mXRN1)| (Strand-exchange protein 1 homolog) (Protein Dhm2) Length = 1719 Score = 29.3 bits (64), Expect = 2.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 180 QPSTSIVSPLPSLLCCRGAPDGR*GGRLH 266 Q T+IV P PS+ C AP G GG H Sbjct: 1183 QKLTAIVKPQPSVSHCSAAPSGHLGGLNH 1211
>CEF1_ASHGO (Q756C3) Pre-mRNA-splicing factor CEF1| Length = 477 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -2 Query: 276 PGHHEADRLSDHLARHGSTRGKAAARRSRCLVGQEEEMEQWR 151 P E + +++ AR ST+GK AARR+R E ++E+ R Sbjct: 128 PEEDEREMVAEARARLASTQGKKAARRAR-----ERQVEESR 164
>CCA_PYRKO (Q5JJ38) CCA-adding enzyme (EC 2.7.7.25) (EC 2.7.7.21) (tRNA| nucleotidyltransferase) (tRNA adenylyl-/cytidylyl- transferase) (tRNA CCA-pyrophosphorylase) (tRNA-NT) Length = 456 Score = 27.7 bits (60), Expect = 7.9 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 208 SGETIEVLGWTGGRDGAMEAGREEEMDKWE 119 S E EVLGW GR GA +A E+D+ E Sbjct: 329 SREGFEVLGWNTGRYGAEKAFVMLELDRVE 358 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,916,795 Number of Sequences: 219361 Number of extensions: 507967 Number of successful extensions: 1436 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1436 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)