| Clone Name | bast13h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNC_RALSO (Q8Y0I1) Ribonuclease III (EC 3.1.26.3) (RNase III) | 30 | 1.4 | 2 | CTPG_MYCTU (P63689) Probable cation-transporting ATPase G (EC 3.... | 27 | 8.8 | 3 | CTPG_MYCBO (P63690) Probable cation-transporting ATPase G (EC 3.... | 27 | 8.8 | 4 | RNC_RALEJ (Q46Z18) Ribonuclease III (EC 3.1.26.3) (RNase III) | 27 | 8.8 |
|---|
>RNC_RALSO (Q8Y0I1) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 256 Score = 30.0 bits (66), Expect = 1.4 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = -1 Query: 357 IRERGQGERPDLAVLEELVGGDHVLARAAEFELRVT*PTVPAAISGTSSSRRGREQ 190 ++E QG + +A+ + V H A +FE+ T P + +SG+ +SRR EQ Sbjct: 157 LQEYLQGHK--IALPQYAVVATHGAAHNQQFEVECTIPKLEIRVSGSGASRRAAEQ 210
>CTPG_MYCTU (P63689) Probable cation-transporting ATPase G (EC 3.6.3.-)| Length = 771 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 294 DHVLARAAEFELRVT*PTVPAAISGTSSSRRGREQQVVDGAG 169 + VLA AA E R P A ++ T ++ + Q V GAG Sbjct: 486 EEVLAVAAALEARSEHPLAVAVLAATQATTAASDVQAVPGAG 527
>CTPG_MYCBO (P63690) Probable cation-transporting ATPase G (EC 3.6.3.-)| Length = 771 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 294 DHVLARAAEFELRVT*PTVPAAISGTSSSRRGREQQVVDGAG 169 + VLA AA E R P A ++ T ++ + Q V GAG Sbjct: 486 EEVLAVAAALEARSEHPLAVAVLAATQATTAASDVQAVPGAG 527
>RNC_RALEJ (Q46Z18) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 256 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = -1 Query: 357 IRERGQGERPDLAVLEELVGGDHVLARAAEFELRVT*PTVPAAISGTSSSRRGREQ 190 ++E QG + +A+ + V H A + +FE+ P + + GT +SRR EQ Sbjct: 157 LQEYLQGHK--IALPQYNVIATHGAAHSQQFEVECMVPKLEVRVFGTGASRRAAEQ 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,036,545 Number of Sequences: 219361 Number of extensions: 451625 Number of successful extensions: 1503 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1502 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)