| Clone Name | bast12f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GTR14_HUMAN (Q8TDB8) Solute carrier family 2, facilitated glucos... | 29 | 5.5 | 2 | SBCC_TREPA (O83635) Nuclease sbcCD subunit C | 28 | 9.4 | 3 | ARR1_ARATH (Q940D0) Two-component response regulator ARR1 | 28 | 9.4 | 4 | DC1L1_RAT (Q9QXU8) Cytoplasmic dynein 1 light intermediate chain... | 28 | 9.4 |
|---|
>GTR14_HUMAN (Q8TDB8) Solute carrier family 2, facilitated glucose transporter| member 14 (Glucose transporter type 14) Length = 520 Score = 28.9 bits (63), Expect = 5.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 305 TNWKTNMLTGLLVPYIFFTMPSLLFSFIRGEIGSWIAF 418 +NW +N L GLL P + + + +F G + +++AF Sbjct: 432 SNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAF 469
>SBCC_TREPA (O83635) Nuclease sbcCD subunit C| Length = 1047 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 385 KGEEQRRHGEENVWDQETRQHVGLPVRLVQHQE 287 + EQ +E + QETR H + RL++HQE Sbjct: 470 RAREQLLQTKEQIHLQETRTHAVVLARLLEHQE 502
>ARR1_ARATH (Q940D0) Two-component response regulator ARR1| Length = 690 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = -3 Query: 388 YKGEEQRRHGEENVWDQETRQHVGLPVRLVQHQEIYGGGEG 266 Y RH + R H P +VQH ++Y G G Sbjct: 592 YSSSSMSRHNTTVAATEHGRNHQQPPSGMVQHHQVYADGNG 632
>DC1L1_RAT (Q9QXU8) Cytoplasmic dynein 1 light intermediate chain 1 (Dynein| light intermediate chain 1, cytosolic) (Dynein light chain A) (DLC-A) Length = 523 Score = 28.1 bits (61), Expect = 9.4 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 77 ARSAMANSFLSMKTGPAAGASEASQALLESDLRELTMAAR 196 A +AN S GPAAG E Q L LRE++ +R Sbjct: 22 ASGPLANELASGSGGPAAGDDEDGQNLWSRILREVSTRSR 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,526,658 Number of Sequences: 219361 Number of extensions: 534184 Number of successful extensions: 1626 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)